Anti USP31 pAb (ATL-HPA006937)
Atlas Antibodies
- Catalog No.:
- ATL-HPA006937-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: USP31
Alternative Gene Name: KIAA1203
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063317: 95%, ENSRNOG00000025793: 96%
Entrez Gene ID: 57478
Uniprot ID: Q70CQ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LASLSESVEMTGERSEDDGGFSTRPFVRSVQRQSLSSRSSVTSPLAVNENCMRPSWSLSAKLQMRSNSPSRFSGDSPIHSSASTLEKIGEAADDKVSISCFGSLRNLSSSYQEPSD |
| Gene Sequence | LASLSESVEMTGERSEDDGGFSTRPFVRSVQRQSLSSRSSVTSPLAVNENCMRPSWSLSAKLQMRSNSPSRFSGDSPIHSSASTLEKIGEAADDKVSISCFGSLRNLSSSYQEPSD |
| Gene ID - Mouse | ENSMUSG00000063317 |
| Gene ID - Rat | ENSRNOG00000025793 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti USP31 pAb (ATL-HPA006937) | |
| Datasheet | Anti USP31 pAb (ATL-HPA006937) Datasheet (External Link) |
| Vendor Page | Anti USP31 pAb (ATL-HPA006937) at Atlas Antibodies |
| Documents & Links for Anti USP31 pAb (ATL-HPA006937) | |
| Datasheet | Anti USP31 pAb (ATL-HPA006937) Datasheet (External Link) |
| Vendor Page | Anti USP31 pAb (ATL-HPA006937) |