Anti USP31 pAb (ATL-HPA006937)

Atlas Antibodies

Catalog No.:
ATL-HPA006937-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ubiquitin specific peptidase 31
Gene Name: USP31
Alternative Gene Name: KIAA1203
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063317: 95%, ENSRNOG00000025793: 96%
Entrez Gene ID: 57478
Uniprot ID: Q70CQ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LASLSESVEMTGERSEDDGGFSTRPFVRSVQRQSLSSRSSVTSPLAVNENCMRPSWSLSAKLQMRSNSPSRFSGDSPIHSSASTLEKIGEAADDKVSISCFGSLRNLSSSYQEPSD
Gene Sequence LASLSESVEMTGERSEDDGGFSTRPFVRSVQRQSLSSRSSVTSPLAVNENCMRPSWSLSAKLQMRSNSPSRFSGDSPIHSSASTLEKIGEAADDKVSISCFGSLRNLSSSYQEPSD
Gene ID - Mouse ENSMUSG00000063317
Gene ID - Rat ENSRNOG00000025793
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti USP31 pAb (ATL-HPA006937)
Datasheet Anti USP31 pAb (ATL-HPA006937) Datasheet (External Link)
Vendor Page Anti USP31 pAb (ATL-HPA006937) at Atlas Antibodies

Documents & Links for Anti USP31 pAb (ATL-HPA006937)
Datasheet Anti USP31 pAb (ATL-HPA006937) Datasheet (External Link)
Vendor Page Anti USP31 pAb (ATL-HPA006937)