Anti USP3 pAb (ATL-HPA060513)

Atlas Antibodies

Catalog No.:
ATL-HPA060513-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ubiquitin specific peptidase 3
Gene Name: USP3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032376: 94%, ENSRNOG00000017714: 88%
Entrez Gene ID: 9960
Uniprot ID: Q9Y6I4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSSVCIAPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSVHCGRYVNGHAKKHYEDAQVPLTNHKKSEKQDKVQHTVCMDCSS
Gene Sequence SSSVCIAPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSVHCGRYVNGHAKKHYEDAQVPLTNHKKSEKQDKVQHTVCMDCSS
Gene ID - Mouse ENSMUSG00000032376
Gene ID - Rat ENSRNOG00000017714
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti USP3 pAb (ATL-HPA060513)
Datasheet Anti USP3 pAb (ATL-HPA060513) Datasheet (External Link)
Vendor Page Anti USP3 pAb (ATL-HPA060513) at Atlas Antibodies

Documents & Links for Anti USP3 pAb (ATL-HPA060513)
Datasheet Anti USP3 pAb (ATL-HPA060513) Datasheet (External Link)
Vendor Page Anti USP3 pAb (ATL-HPA060513)