Anti USP29 pAb (ATL-HPA076515 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA076515-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ubiquitin specific peptidase 29
Gene Name: USP29
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033364: 38%, ENSRNOG00000022720: 40%
Entrez Gene ID: 57663
Uniprot ID: Q9HBJ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SQGMAEQLQQCIEESIIDEFLQQAPPPGVRKLDAQEHTEETLNQSTELRLQKADLNHLGALGSDNPGNKNILDAENTRGEAKELTRNVKMG
Gene Sequence SQGMAEQLQQCIEESIIDEFLQQAPPPGVRKLDAQEHTEETLNQSTELRLQKADLNHLGALGSDNPGNKNILDAENTRGEAKELTRNVKMG
Gene ID - Mouse ENSMUSG00000033364
Gene ID - Rat ENSRNOG00000022720
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti USP29 pAb (ATL-HPA076515 w/enhanced validation)
Datasheet Anti USP29 pAb (ATL-HPA076515 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti USP29 pAb (ATL-HPA076515 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti USP29 pAb (ATL-HPA076515 w/enhanced validation)
Datasheet Anti USP29 pAb (ATL-HPA076515 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti USP29 pAb (ATL-HPA076515 w/enhanced validation)