Anti USP26 pAb (ATL-HPA027310)

Atlas Antibodies

Catalog No.:
ATL-HPA027310-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ubiquitin specific peptidase 26
Gene Name: USP26
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038056: 24%, ENSRNOG00000019504: 25%
Entrez Gene ID: 83844
Uniprot ID: Q9BXU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RKMTSGNISVSWPATKESKDILAPHIGSDKESEQKKGQTVFKGASRRQQQKYLGKNSKPNELESVYSGDRAFIEKEPLAHLMTYLEDTSLCQFHKAGGKPASSPGTPLS
Gene Sequence RKMTSGNISVSWPATKESKDILAPHIGSDKESEQKKGQTVFKGASRRQQQKYLGKNSKPNELESVYSGDRAFIEKEPLAHLMTYLEDTSLCQFHKAGGKPASSPGTPLS
Gene ID - Mouse ENSMUSG00000038056
Gene ID - Rat ENSRNOG00000019504
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti USP26 pAb (ATL-HPA027310)
Datasheet Anti USP26 pAb (ATL-HPA027310) Datasheet (External Link)
Vendor Page Anti USP26 pAb (ATL-HPA027310) at Atlas Antibodies

Documents & Links for Anti USP26 pAb (ATL-HPA027310)
Datasheet Anti USP26 pAb (ATL-HPA027310) Datasheet (External Link)
Vendor Page Anti USP26 pAb (ATL-HPA027310)