Anti USP1 pAb (ATL-HPA028440 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA028440-25

Protein Description: ubiquitin specific peptidase 1
Gene Name: USP1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028560: 76%, ENSRNOG00000007890: 80%
Entrez Gene ID: 7398
Uniprot ID: O94782
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KATSDTLESPPKIIPKYISENESPRPSQKKSRVKINWLKSATKQPSILSKFCSLGKITTNQGVKGQSKENECDP
• Gene Sequence: KATSDTLESPPKIIPKYISENESPRPSQKKSRVKINWLKSATKQPSILSKFCSLGKITTNQGVKGQSKENECDP
• Gene ID - Mouse: ENSMUSG00000028560
• Gene ID - Rat: ENSRNOG00000007890
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti USP1 pAb (ATL-HPA028440 w/enhanced validation) – 2 Found

Sonego, Maura; Pellarin, Ilenia; Costa, Alice; Vinciguerra, Gian Luca Rampioni; Coan, Michela; Kraut, Alexandra; D'Andrea, Sara; Dall'Acqua, Alessandra; Castillo-Tong, Dan Cacsire; Califano, Daniela; Losito, Simona; Spizzo, Riccardo; Couté, Yohann; Vecchione, Andrea; Belletti, Barbara; Schiappacassi, Monica; Baldassarre, Gustavo. USP1 links platinum resistance to cancer cell dissemination by regulating Snail stability. Science Advances. 2019;5(5):eaav3235. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.