Anti USHBP1 pAb (ATL-HPA052471)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052471-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: USHBP1
Alternative Gene Name: AIEBP, FLJ38709, MCC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034911: 55%, ENSRNOG00000023485: 56%
Entrez Gene ID: 83878
Uniprot ID: Q8N6Y0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TLQHTLSSLEAAAAAWRHQPPSHSGPMEFEGTSEGGAGSLGKQEGAGSCQREAARLAERNAWLRLALSSREDELVRTQASLEAIRAEKETLQKEVQELQDSLLRLEPCPHLSHNQAGG |
Gene Sequence | TLQHTLSSLEAAAAAWRHQPPSHSGPMEFEGTSEGGAGSLGKQEGAGSCQREAARLAERNAWLRLALSSREDELVRTQASLEAIRAEKETLQKEVQELQDSLLRLEPCPHLSHNQAGG |
Gene ID - Mouse | ENSMUSG00000034911 |
Gene ID - Rat | ENSRNOG00000023485 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti USHBP1 pAb (ATL-HPA052471) | |
Datasheet | Anti USHBP1 pAb (ATL-HPA052471) Datasheet (External Link) |
Vendor Page | Anti USHBP1 pAb (ATL-HPA052471) at Atlas Antibodies |
Documents & Links for Anti USHBP1 pAb (ATL-HPA052471) | |
Datasheet | Anti USHBP1 pAb (ATL-HPA052471) Datasheet (External Link) |
Vendor Page | Anti USHBP1 pAb (ATL-HPA052471) |