Anti USHBP1 pAb (ATL-HPA052471)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052471-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: USHBP1
Alternative Gene Name: AIEBP, FLJ38709, MCC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034911: 55%, ENSRNOG00000023485: 56%
Entrez Gene ID: 83878
Uniprot ID: Q8N6Y0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TLQHTLSSLEAAAAAWRHQPPSHSGPMEFEGTSEGGAGSLGKQEGAGSCQREAARLAERNAWLRLALSSREDELVRTQASLEAIRAEKETLQKEVQELQDSLLRLEPCPHLSHNQAGG |
| Gene Sequence | TLQHTLSSLEAAAAAWRHQPPSHSGPMEFEGTSEGGAGSLGKQEGAGSCQREAARLAERNAWLRLALSSREDELVRTQASLEAIRAEKETLQKEVQELQDSLLRLEPCPHLSHNQAGG |
| Gene ID - Mouse | ENSMUSG00000034911 |
| Gene ID - Rat | ENSRNOG00000023485 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti USHBP1 pAb (ATL-HPA052471) | |
| Datasheet | Anti USHBP1 pAb (ATL-HPA052471) Datasheet (External Link) |
| Vendor Page | Anti USHBP1 pAb (ATL-HPA052471) at Atlas Antibodies |
| Documents & Links for Anti USHBP1 pAb (ATL-HPA052471) | |
| Datasheet | Anti USHBP1 pAb (ATL-HPA052471) Datasheet (External Link) |
| Vendor Page | Anti USHBP1 pAb (ATL-HPA052471) |