Anti USF3 pAb (ATL-HPA029243)

Atlas Antibodies

Catalog No.: ATL-HPA029243-25

Protein Description: upstream transcription factor family member 3
Gene Name: USF3
Alternative Gene Name: KIAA2018
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068284: 94%, ENSRNOG00000027756: 94%
Entrez Gene ID: 205717
Uniprot ID: Q68DE3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTSRGLEQQMVSQPSIVTRSSDMTCTPHRPERNRVSSYSAEALIGKTSSNSEQRMGISIQGSRVSDQLEMRSYLDVPRNK
• Gene Sequence: LTSRGLEQQMVSQPSIVTRSSDMTCTPHRPERNRVSSYSAEALIGKTSSNSEQRMGISIQGSRVSDQLEMRSYLDVPRNK
• Gene ID - Mouse: ENSMUSG00000068284
• Gene ID - Rat: ENSRNOG00000027756
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.