Anti USB1 pAb (ATL-HPA059854)

Atlas Antibodies

Catalog No.: ATL-HPA059854-25

Protein Description: U6 snRNA biogenesis 1
Gene Name: USB1
Alternative Gene Name: C16orf57, FLJ13154, HVSL1, Mpn1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031792: 70%, ENSRNOG00000013216: 75%
Entrez Gene ID: 79650
Uniprot ID: Q9BQ65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESEDGMRTRPGDGSHRRGQSPLPRQRFPVPDSVLNMFPGTEEGPEDDSTKHGGRVRTFPHERGNWATHVYVPYEAKEEFLDLLD
• Gene Sequence: ESEDGMRTRPGDGSHRRGQSPLPRQRFPVPDSVLNMFPGTEEGPEDDSTKHGGRVRTFPHERGNWATHVYVPYEAKEEFLDLLD
• Gene ID - Mouse: ENSMUSG00000031792
• Gene ID - Rat: ENSRNOG00000013216
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.