Anti UROD pAb (ATL-HPA030350)

Atlas Antibodies

Catalog No.:
ATL-HPA030350-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: uroporphyrinogen decarboxylase
Gene Name: UROD
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028684: 93%, ENSRNOG00000018211: 94%
Entrez Gene ID: 7389
Uniprot ID: P06132
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQN
Gene Sequence GLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQN
Gene ID - Mouse ENSMUSG00000028684
Gene ID - Rat ENSRNOG00000018211
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UROD pAb (ATL-HPA030350)
Datasheet Anti UROD pAb (ATL-HPA030350) Datasheet (External Link)
Vendor Page Anti UROD pAb (ATL-HPA030350) at Atlas Antibodies

Documents & Links for Anti UROD pAb (ATL-HPA030350)
Datasheet Anti UROD pAb (ATL-HPA030350) Datasheet (External Link)
Vendor Page Anti UROD pAb (ATL-HPA030350)