Anti UROD pAb (ATL-HPA027468)

Atlas Antibodies

Catalog No.:
ATL-HPA027468-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: uroporphyrinogen decarboxylase
Gene Name: UROD
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028684: 86%, ENSRNOG00000018211: 87%
Entrez Gene ID: 7389
Uniprot ID: P06132
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHF
Gene Sequence ALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHF
Gene ID - Mouse ENSMUSG00000028684
Gene ID - Rat ENSRNOG00000018211
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UROD pAb (ATL-HPA027468)
Datasheet Anti UROD pAb (ATL-HPA027468) Datasheet (External Link)
Vendor Page Anti UROD pAb (ATL-HPA027468) at Atlas Antibodies

Documents & Links for Anti UROD pAb (ATL-HPA027468)
Datasheet Anti UROD pAb (ATL-HPA027468) Datasheet (External Link)
Vendor Page Anti UROD pAb (ATL-HPA027468)