Anti URI1 pAb (ATL-HPA071709)

Atlas Antibodies

Catalog No.:
ATL-HPA071709-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: URI1, prefoldin-like chaperone
Gene Name: URI1
Alternative Gene Name: C19orf2, FLJ10575, NNX3, PPP1R19, RMP, URI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030421: 66%, ENSRNOG00000014463: 70%
Entrez Gene ID: 8725
Uniprot ID: O94763
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ILEEEPQENQKKLLPLSVTPEAFSGTVIEKEFVSPSLTPPPAIAHPALPTIPERKEVLLEASEETGK
Gene Sequence ILEEEPQENQKKLLPLSVTPEAFSGTVIEKEFVSPSLTPPPAIAHPALPTIPERKEVLLEASEETGK
Gene ID - Mouse ENSMUSG00000030421
Gene ID - Rat ENSRNOG00000014463
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti URI1 pAb (ATL-HPA071709)
Datasheet Anti URI1 pAb (ATL-HPA071709) Datasheet (External Link)
Vendor Page Anti URI1 pAb (ATL-HPA071709) at Atlas Antibodies

Documents & Links for Anti URI1 pAb (ATL-HPA071709)
Datasheet Anti URI1 pAb (ATL-HPA071709) Datasheet (External Link)
Vendor Page Anti URI1 pAb (ATL-HPA071709)