Anti URI1 pAb (ATL-HPA071709)

Atlas Antibodies

Catalog No.: ATL-HPA071709-25

Protein Description: URI1, prefoldin-like chaperone
Gene Name: URI1
Alternative Gene Name: C19orf2, FLJ10575, NNX3, PPP1R19, RMP, URI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030421: 66%, ENSRNOG00000014463: 70%
Entrez Gene ID: 8725
Uniprot ID: O94763
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ILEEEPQENQKKLLPLSVTPEAFSGTVIEKEFVSPSLTPPPAIAHPALPTIPERKEVLLEASEETGK
• Gene Sequence: ILEEEPQENQKKLLPLSVTPEAFSGTVIEKEFVSPSLTPPPAIAHPALPTIPERKEVLLEASEETGK
• Gene ID - Mouse: ENSMUSG00000030421
• Gene ID - Rat: ENSRNOG00000014463
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.