Anti UQCRQ pAb (ATL-HPA053323)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053323-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: UQCRQ
Alternative Gene Name: QCR8, QP-C, UQCR7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044894: 70%, ENSRNOG00000048174: 68%
Entrez Gene ID: 27089
Uniprot ID: O14949
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAY |
| Gene Sequence | IRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAY |
| Gene ID - Mouse | ENSMUSG00000044894 |
| Gene ID - Rat | ENSRNOG00000048174 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UQCRQ pAb (ATL-HPA053323) | |
| Datasheet | Anti UQCRQ pAb (ATL-HPA053323) Datasheet (External Link) |
| Vendor Page | Anti UQCRQ pAb (ATL-HPA053323) at Atlas Antibodies |
| Documents & Links for Anti UQCRQ pAb (ATL-HPA053323) | |
| Datasheet | Anti UQCRQ pAb (ATL-HPA053323) Datasheet (External Link) |
| Vendor Page | Anti UQCRQ pAb (ATL-HPA053323) |