Anti UQCRC1 pAb (ATL-HPA002815 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA002815-25

Protein Description: ubiquinol-cytochrome c reductase core protein I
Gene Name: UQCRC1
Alternative Gene Name: D3S3191, QCR1, UQCR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000107235: 89%, ENSRNOG00000032134: 87%
Entrez Gene ID: 7384
Uniprot ID: P31930
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GDIVQNCSLEDSQIEKERDVILREMQENDASMRDVVFNYLHATAFQGTPLAQAVEGPSENVRKLSRADLTEYLSTHYKAPRMVLAAAGGVEHQQLLDLAQKHLGG
• Gene Sequence: GDIVQNCSLEDSQIEKERDVILREMQENDASMRDVVFNYLHATAFQGTPLAQAVEGPSENVRKLSRADLTEYLSTHYKAPRMVLAAAGGVEHQQLLDLAQKHLGG
• Gene ID - Mouse: ENSMUSG00000107235
• Gene ID - Rat: ENSRNOG00000032134
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti UQCRC1 pAb (ATL-HPA002815 w/enhanced validation) – 6 Found

Rhein, Virginie F; Carroll, Joe; Ding, Shujing; Fearnley, Ian M; Walker, John E. NDUFAF5 Hydroxylates NDUFS7 at an Early Stage in the Assembly of Human Complex I. The Journal Of Biological Chemistry. 2016;291(28):14851-60. 

Mohanraj, Karthik; Wasilewski, Michal; Benincá, Cristiane; Cysewski, Dominik; Poznanski, Jaroslaw; Sakowska, Paulina; Bugajska, Zaneta; Deckers, Markus; Dennerlein, Sven; Fernandez-Vizarra, Erika; Rehling, Peter; Dadlez, Michal; Zeviani, Massimo; Chacinska, Agnieszka. Inhibition of proteasome rescues a pathogenic variant of respiratory chain assembly factor COA7. Embo Molecular Medicine. 2019;11(5) 

Skalnikova, Helena Kupcova; Bohuslavova, Bozena; Turnovcova, Karolina; Juhasova, Jana; Juhas, Stefan; Rodinova, Marie; Vodicka, Petr. Isolation and Characterization of Small Extracellular Vesicles from Porcine Blood Plasma, Cerebrospinal Fluid, and Seminal Plasma. Proteomes. 2019;7(2) 

Zong, Nobel C; Li, Haomin; Li, Hua; Lam, Maggie P Y; Jimenez, Rafael C; Kim, Christina S; Deng, Ning; Kim, Allen K; Choi, Jeong Ho; Zelaya, Ivette; Liem, David; Meyer, David; Odeberg, Jacob; Fang, Caiyun; Lu, Hao-Jie; Xu, Tao; Weiss, James; Duan, Huilong; Uhlen, Mathias; Yates, John R 3rd; Apweiler, Rolf; Ge, Junbo; Hermjakob, Henning; Ping, Peipei. Integration of cardiac proteome biology and medicine by a specialized knowledgebase. Circulation Research. 2013;113(9):1043-53. 

Desmurs, Marjorie; Foti, Michelangelo; Raemy, Etienne; Vaz, Frédéric Maxime; Martinou, Jean-Claude; Bairoch, Amos; Lane, Lydie. C11orf83, a mitochondrial cardiolipin-binding protein involved in bc1 complex assembly and supercomplex stabilization. Molecular And Cellular Biology. 2015;35(7):1139-56. 

Chojnacka, Katarzyna Justyna; Elancheliyan, Praveenraj; Mussulini, Ben Hur Marins; Mohanraj, Karthik; Callegari, Sylvie; Gosk, Aleksandra; Banach, Tomasz; Góral, Tomasz; Szczepanowska, Karolina; Rehling, Peter; Serwa, Remigiusz Adam; Chacinska, Agnieszka. Ovarian carcinoma immunoreactive antigen-like protein 2 (OCIAD2) is a novel complex III-specific assembly factor in mitochondria. Molecular Biology Of The Cell. 2022;33(4):ar29.