Anti UPP2 pAb (ATL-HPA035225 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035225-25

Protein Description: uridine phosphorylase 2
Gene Name: UPP2
Alternative Gene Name: UDRPASE2, UP2, UPASE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026839: 87%, ENSRNOG00000005341: 87%
Entrez Gene ID: 151531
Uniprot ID: O95045
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GIGIAPGTVVITDIAVDSFFKPRFEQVILDNIVTRSTELDKELSEELFNCSKEIPNFPTLVGHTMCT
• Gene Sequence: GIGIAPGTVVITDIAVDSFFKPRFEQVILDNIVTRSTELDKELSEELFNCSKEIPNFPTLVGHTMCT
• Gene ID - Mouse: ENSMUSG00000026839
• Gene ID - Rat: ENSRNOG00000005341
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.