Anti UPP1 pAb (ATL-HPA055394 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA055394-100
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: uridine phosphorylase 1
Gene Name: UPP1
Alternative Gene Name: UDRPASE, UP, UPASE, UPP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020407: 64%, ENSRNOG00000004972: 63%
Entrez Gene ID: 7378
Uniprot ID: Q16831
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFP
Gene Sequence TGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFP
Gene ID - Mouse ENSMUSG00000020407
Gene ID - Rat ENSRNOG00000004972
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UPP1 pAb (ATL-HPA055394 w/enhanced validation)
Datasheet Anti UPP1 pAb (ATL-HPA055394 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti UPP1 pAb (ATL-HPA055394 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti UPP1 pAb (ATL-HPA055394 w/enhanced validation)
Datasheet Anti UPP1 pAb (ATL-HPA055394 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti UPP1 pAb (ATL-HPA055394 w/enhanced validation)