Anti UPK2 pAb (ATL-HPA043312 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043312-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: UPK2
Alternative Gene Name: MGC138598, UP2, UPII
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041523: 95%, ENSRNOG00000043324: 95%
Entrez Gene ID: 7379
Uniprot ID: O00526
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ISSLSGLLSPALTESLLVALPPCHLTGGNATLMVRRANDSKVVTSSFVVPPCRGRRELVS |
| Gene Sequence | ISSLSGLLSPALTESLLVALPPCHLTGGNATLMVRRANDSKVVTSSFVVPPCRGRRELVS |
| Gene ID - Mouse | ENSMUSG00000041523 |
| Gene ID - Rat | ENSRNOG00000043324 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UPK2 pAb (ATL-HPA043312 w/enhanced validation) | |
| Datasheet | Anti UPK2 pAb (ATL-HPA043312 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti UPK2 pAb (ATL-HPA043312 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti UPK2 pAb (ATL-HPA043312 w/enhanced validation) | |
| Datasheet | Anti UPK2 pAb (ATL-HPA043312 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti UPK2 pAb (ATL-HPA043312 w/enhanced validation) |
| Citations for Anti UPK2 pAb (ATL-HPA043312 w/enhanced validation) – 1 Found |
| Garzón, Ingrid; Jaimes-Parra, Boris Damián; Pascual-Geler, Manrique; Cózar, José Manuel; Sánchez-Quevedo, María Del Carmen; Mosquera-Pacheco, María Auxiliadora; Sánchez-Montesinos, Indalecio; Fernández-Valadés, Ricardo; Campos, Fernando; Alaminos, Miguel. Biofabrication of a Tubular Model of Human Urothelial Mucosa Using Human Wharton Jelly Mesenchymal Stromal Cells. Polymers. 2021;13(10) PubMed |