Anti UPF3B pAb (ATL-HPA001800)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001800-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: UPF3B
Alternative Gene Name: HUPF3B, MRX62, RENT3B, UPF3X
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036572: 80%, ENSRNOG00000039994: 80%
Entrez Gene ID: 65109
Uniprot ID: Q9BZI7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AKKLDKENLSDERASGQSCTLPKRSDSELKDEKPKRPEDESGRDYREREREYERDQERILRERERLKRQEEERRRQKERYEKEKTFKRKEEEMKKEKDTLRDKGKKAESTESIGSSEKTEKKEEVVKRDRIRNKDR |
| Gene Sequence | AKKLDKENLSDERASGQSCTLPKRSDSELKDEKPKRPEDESGRDYREREREYERDQERILRERERLKRQEEERRRQKERYEKEKTFKRKEEEMKKEKDTLRDKGKKAESTESIGSSEKTEKKEEVVKRDRIRNKDR |
| Gene ID - Mouse | ENSMUSG00000036572 |
| Gene ID - Rat | ENSRNOG00000039994 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UPF3B pAb (ATL-HPA001800) | |
| Datasheet | Anti UPF3B pAb (ATL-HPA001800) Datasheet (External Link) |
| Vendor Page | Anti UPF3B pAb (ATL-HPA001800) at Atlas Antibodies |
| Documents & Links for Anti UPF3B pAb (ATL-HPA001800) | |
| Datasheet | Anti UPF3B pAb (ATL-HPA001800) Datasheet (External Link) |
| Vendor Page | Anti UPF3B pAb (ATL-HPA001800) |
| Citations for Anti UPF3B pAb (ATL-HPA001800) – 1 Found |
| Michalak, Malwina; Katzenmaier, Eva-Maria; Roeckel, Nina; Woerner, Stefan M; Fuchs, Vera; Warnken, Uwe; Yuan, Yan P; Bork, Peer; Neu-Yilik, Gabriele; Kulozik, Andreas; von Knebel Doeberitz, Magnus; Kloor, Matthias; Kopitz, Jürgen; Gebert, Johannes. (Phospho)proteomic Profiling of Microsatellite Unstable CRC Cells Reveals Alterations in Nuclear Signaling and Cholesterol Metabolism Caused by Frameshift Mutation of NMD Regulator UPF3A. International Journal Of Molecular Sciences. 2020;21(15) PubMed |