Anti UPF3B pAb (ATL-HPA001800)

Atlas Antibodies

Catalog No.:
ATL-HPA001800-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: UPF3 regulator of nonsense transcripts homolog B (yeast)
Gene Name: UPF3B
Alternative Gene Name: HUPF3B, MRX62, RENT3B, UPF3X
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036572: 80%, ENSRNOG00000039994: 80%
Entrez Gene ID: 65109
Uniprot ID: Q9BZI7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen AKKLDKENLSDERASGQSCTLPKRSDSELKDEKPKRPEDESGRDYREREREYERDQERILRERERLKRQEEERRRQKERYEKEKTFKRKEEEMKKEKDTLRDKGKKAESTESIGSSEKTEKKEEVVKRDRIRNKDR
Gene Sequence AKKLDKENLSDERASGQSCTLPKRSDSELKDEKPKRPEDESGRDYREREREYERDQERILRERERLKRQEEERRRQKERYEKEKTFKRKEEEMKKEKDTLRDKGKKAESTESIGSSEKTEKKEEVVKRDRIRNKDR
Gene ID - Mouse ENSMUSG00000036572
Gene ID - Rat ENSRNOG00000039994
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UPF3B pAb (ATL-HPA001800)
Datasheet Anti UPF3B pAb (ATL-HPA001800) Datasheet (External Link)
Vendor Page Anti UPF3B pAb (ATL-HPA001800) at Atlas Antibodies

Documents & Links for Anti UPF3B pAb (ATL-HPA001800)
Datasheet Anti UPF3B pAb (ATL-HPA001800) Datasheet (External Link)
Vendor Page Anti UPF3B pAb (ATL-HPA001800)
Citations for Anti UPF3B pAb (ATL-HPA001800) – 1 Found
Michalak, Malwina; Katzenmaier, Eva-Maria; Roeckel, Nina; Woerner, Stefan M; Fuchs, Vera; Warnken, Uwe; Yuan, Yan P; Bork, Peer; Neu-Yilik, Gabriele; Kulozik, Andreas; von Knebel Doeberitz, Magnus; Kloor, Matthias; Kopitz, Jürgen; Gebert, Johannes. (Phospho)proteomic Profiling of Microsatellite Unstable CRC Cells Reveals Alterations in Nuclear Signaling and Cholesterol Metabolism Caused by Frameshift Mutation of NMD Regulator UPF3A. International Journal Of Molecular Sciences. 2020;21(15)  PubMed