Anti UPF3A pAb (ATL-HPA018325)

Atlas Antibodies

Catalog No.: ATL-HPA018325-25

Protein Description: UPF3 regulator of nonsense transcripts homolog A (yeast)
Gene Name: UPF3A
Alternative Gene Name: HUPF3A, RENT3A, UPF3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038398: 46%, ENSRNOG00000017397: 47%
Entrez Gene ID: 65110
Uniprot ID: Q9H1J1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KARPMEGSLEEPQETSHSGSDKEHRDVERSQEQESEAQRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKK
• Gene Sequence: KARPMEGSLEEPQETSHSGSDKEHRDVERSQEQESEAQRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKK
• Gene ID - Mouse: ENSMUSG00000038398
• Gene ID - Rat: ENSRNOG00000017397
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti UPF3A pAb (ATL-HPA018325) – 1 Found

Michalak, Malwina; Katzenmaier, Eva-Maria; Roeckel, Nina; Woerner, Stefan M; Fuchs, Vera; Warnken, Uwe; Yuan, Yan P; Bork, Peer; Neu-Yilik, Gabriele; Kulozik, Andreas; von Knebel Doeberitz, Magnus; Kloor, Matthias; Kopitz, Jürgen; Gebert, Johannes. (Phospho)proteomic Profiling of Microsatellite Unstable CRC Cells Reveals Alterations in Nuclear Signaling and Cholesterol Metabolism Caused by Frameshift Mutation of NMD Regulator UPF3A. International Journal Of Molecular Sciences. 2020;21(15)