Anti UNKL pAb (ATL-HPA055801)

Atlas Antibodies

Catalog No.:
ATL-HPA055801-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: unkempt family zinc finger-like
Gene Name: UNKL
Alternative Gene Name: C16orf28, FLJ23360, ZC3H5L, ZC3HDC5L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015127: 83%, ENSRNOG00000054605: 86%
Entrez Gene ID: 64718
Uniprot ID: Q9H9P5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QEELEGLGVASTLPGLRGCGDIGTIPLPKLHSLQSQLRLDLEAVDGVIFQLRAKQCVACRERAHGAVLRPCQHHILCEPCAATAPECPYC
Gene Sequence QEELEGLGVASTLPGLRGCGDIGTIPLPKLHSLQSQLRLDLEAVDGVIFQLRAKQCVACRERAHGAVLRPCQHHILCEPCAATAPECPYC
Gene ID - Mouse ENSMUSG00000015127
Gene ID - Rat ENSRNOG00000054605
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UNKL pAb (ATL-HPA055801)
Datasheet Anti UNKL pAb (ATL-HPA055801) Datasheet (External Link)
Vendor Page Anti UNKL pAb (ATL-HPA055801) at Atlas Antibodies

Documents & Links for Anti UNKL pAb (ATL-HPA055801)
Datasheet Anti UNKL pAb (ATL-HPA055801) Datasheet (External Link)
Vendor Page Anti UNKL pAb (ATL-HPA055801)