Anti UNKL pAb (ATL-HPA055801)

Atlas Antibodies

Catalog No.: ATL-HPA055801-25

Protein Description: unkempt family zinc finger-like
Gene Name: UNKL
Alternative Gene Name: C16orf28, FLJ23360, ZC3H5L, ZC3HDC5L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015127: 83%, ENSRNOG00000054605: 86%
Entrez Gene ID: 64718
Uniprot ID: Q9H9P5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QEELEGLGVASTLPGLRGCGDIGTIPLPKLHSLQSQLRLDLEAVDGVIFQLRAKQCVACRERAHGAVLRPCQHHILCEPCAATAPECPYC
• Gene Sequence: QEELEGLGVASTLPGLRGCGDIGTIPLPKLHSLQSQLRLDLEAVDGVIFQLRAKQCVACRERAHGAVLRPCQHHILCEPCAATAPECPYC
• Gene ID - Mouse: ENSMUSG00000015127
• Gene ID - Rat: ENSRNOG00000054605
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.