Anti UNKL pAb (ATL-HPA055801)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055801-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: UNKL
Alternative Gene Name: C16orf28, FLJ23360, ZC3H5L, ZC3HDC5L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015127: 83%, ENSRNOG00000054605: 86%
Entrez Gene ID: 64718
Uniprot ID: Q9H9P5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QEELEGLGVASTLPGLRGCGDIGTIPLPKLHSLQSQLRLDLEAVDGVIFQLRAKQCVACRERAHGAVLRPCQHHILCEPCAATAPECPYC |
| Gene Sequence | QEELEGLGVASTLPGLRGCGDIGTIPLPKLHSLQSQLRLDLEAVDGVIFQLRAKQCVACRERAHGAVLRPCQHHILCEPCAATAPECPYC |
| Gene ID - Mouse | ENSMUSG00000015127 |
| Gene ID - Rat | ENSRNOG00000054605 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UNKL pAb (ATL-HPA055801) | |
| Datasheet | Anti UNKL pAb (ATL-HPA055801) Datasheet (External Link) |
| Vendor Page | Anti UNKL pAb (ATL-HPA055801) at Atlas Antibodies |
| Documents & Links for Anti UNKL pAb (ATL-HPA055801) | |
| Datasheet | Anti UNKL pAb (ATL-HPA055801) Datasheet (External Link) |
| Vendor Page | Anti UNKL pAb (ATL-HPA055801) |