Anti-UNG pAb (ATL-HPA071225)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071225-100
- Shipping:
- Calculated at Checkout
$554.00
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGL |
| Gene Sequence | GESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGL |
| Gene ID - Mouse | ENSMUSG00000029591 |
| Gene ID - Rat | ENSRNOG00000000692 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti-UNG pAb (ATL-HPA071225) | |
| Vendor Page | Anti-UNG pAb (ATL-HPA071225) at Atlas Antibodies |
| Documents & Links for Anti-UNG pAb (ATL-HPA071225) | |
| Vendor Page | Anti-UNG pAb (ATL-HPA071225) |