Anti UNC80 pAb (ATL-HPA050959)

Atlas Antibodies

Catalog No.:
ATL-HPA050959-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: unc-80 homolog, NALCN channel complex subunit
Gene Name: UNC80
Alternative Gene Name: C2orf21, FLJ33496, KIAA1843, UNC-80
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055567: 100%, ENSRNOG00000028362: 100%
Entrez Gene ID: 285175
Uniprot ID: Q8N2C7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLGKQYEASCVSFERVLVENKLHGLSPALSEAIQSISRWELVQAALPHVLHCTATLLSNRNKLGHQDKLGVAETKLLHTLHWML
Gene Sequence KLGKQYEASCVSFERVLVENKLHGLSPALSEAIQSISRWELVQAALPHVLHCTATLLSNRNKLGHQDKLGVAETKLLHTLHWML
Gene ID - Mouse ENSMUSG00000055567
Gene ID - Rat ENSRNOG00000028362
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UNC80 pAb (ATL-HPA050959)
Datasheet Anti UNC80 pAb (ATL-HPA050959) Datasheet (External Link)
Vendor Page Anti UNC80 pAb (ATL-HPA050959) at Atlas Antibodies

Documents & Links for Anti UNC80 pAb (ATL-HPA050959)
Datasheet Anti UNC80 pAb (ATL-HPA050959) Datasheet (External Link)
Vendor Page Anti UNC80 pAb (ATL-HPA050959)