Anti UNC80 pAb (ATL-HPA050959)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050959-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: UNC80
Alternative Gene Name: C2orf21, FLJ33496, KIAA1843, UNC-80
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055567: 100%, ENSRNOG00000028362: 100%
Entrez Gene ID: 285175
Uniprot ID: Q8N2C7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KLGKQYEASCVSFERVLVENKLHGLSPALSEAIQSISRWELVQAALPHVLHCTATLLSNRNKLGHQDKLGVAETKLLHTLHWML |
| Gene Sequence | KLGKQYEASCVSFERVLVENKLHGLSPALSEAIQSISRWELVQAALPHVLHCTATLLSNRNKLGHQDKLGVAETKLLHTLHWML |
| Gene ID - Mouse | ENSMUSG00000055567 |
| Gene ID - Rat | ENSRNOG00000028362 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UNC80 pAb (ATL-HPA050959) | |
| Datasheet | Anti UNC80 pAb (ATL-HPA050959) Datasheet (External Link) |
| Vendor Page | Anti UNC80 pAb (ATL-HPA050959) at Atlas Antibodies |
| Documents & Links for Anti UNC80 pAb (ATL-HPA050959) | |
| Datasheet | Anti UNC80 pAb (ATL-HPA050959) Datasheet (External Link) |
| Vendor Page | Anti UNC80 pAb (ATL-HPA050959) |