Anti UNC80 pAb (ATL-HPA050959)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050959-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: UNC80
Alternative Gene Name: C2orf21, FLJ33496, KIAA1843, UNC-80
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055567: 100%, ENSRNOG00000028362: 100%
Entrez Gene ID: 285175
Uniprot ID: Q8N2C7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KLGKQYEASCVSFERVLVENKLHGLSPALSEAIQSISRWELVQAALPHVLHCTATLLSNRNKLGHQDKLGVAETKLLHTLHWML |
Gene Sequence | KLGKQYEASCVSFERVLVENKLHGLSPALSEAIQSISRWELVQAALPHVLHCTATLLSNRNKLGHQDKLGVAETKLLHTLHWML |
Gene ID - Mouse | ENSMUSG00000055567 |
Gene ID - Rat | ENSRNOG00000028362 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti UNC80 pAb (ATL-HPA050959) | |
Datasheet | Anti UNC80 pAb (ATL-HPA050959) Datasheet (External Link) |
Vendor Page | Anti UNC80 pAb (ATL-HPA050959) at Atlas Antibodies |
Documents & Links for Anti UNC80 pAb (ATL-HPA050959) | |
Datasheet | Anti UNC80 pAb (ATL-HPA050959) Datasheet (External Link) |
Vendor Page | Anti UNC80 pAb (ATL-HPA050959) |