Anti UNC79 pAb (ATL-HPA071881)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071881-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: UNC79
Alternative Gene Name: KIAA1409
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021198: 80%, ENSRNOG00000008728: 79%
Entrez Gene ID: 57578
Uniprot ID: Q9P2D8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SFALPEMSLDDHPDPGTEGEKPGELMPSSGAKTVLLKVPEDAENPTESEKPDTSAESDTEQNPERKVEEDGAEESEFKIQIVPRQRKQRKIAVSA |
| Gene Sequence | SFALPEMSLDDHPDPGTEGEKPGELMPSSGAKTVLLKVPEDAENPTESEKPDTSAESDTEQNPERKVEEDGAEESEFKIQIVPRQRKQRKIAVSA |
| Gene ID - Mouse | ENSMUSG00000021198 |
| Gene ID - Rat | ENSRNOG00000008728 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UNC79 pAb (ATL-HPA071881) | |
| Datasheet | Anti UNC79 pAb (ATL-HPA071881) Datasheet (External Link) |
| Vendor Page | Anti UNC79 pAb (ATL-HPA071881) at Atlas Antibodies |
| Documents & Links for Anti UNC79 pAb (ATL-HPA071881) | |
| Datasheet | Anti UNC79 pAb (ATL-HPA071881) Datasheet (External Link) |
| Vendor Page | Anti UNC79 pAb (ATL-HPA071881) |