Anti UNC5B pAb (ATL-HPA076687)
Atlas Antibodies
- SKU:
- ATL-HPA076687-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: UNC5B
Alternative Gene Name: p53RDL1, UNC5H2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020099: 91%, ENSRNOG00000000567: 90%
Entrez Gene ID: 219699
Uniprot ID: Q8IZJ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SASLGSQQLLGLPRDPGSSVSGTFGCLGGRLSIPGTGVSLLVPNGAIPQGKFYEMYLLINKAESTLPLSE |
Gene Sequence | SASLGSQQLLGLPRDPGSSVSGTFGCLGGRLSIPGTGVSLLVPNGAIPQGKFYEMYLLINKAESTLPLSE |
Gene ID - Mouse | ENSMUSG00000020099 |
Gene ID - Rat | ENSRNOG00000000567 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti UNC5B pAb (ATL-HPA076687) | |
Datasheet | Anti UNC5B pAb (ATL-HPA076687) Datasheet (External Link) |
Vendor Page | Anti UNC5B pAb (ATL-HPA076687) at Atlas Antibodies |
Documents & Links for Anti UNC5B pAb (ATL-HPA076687) | |
Datasheet | Anti UNC5B pAb (ATL-HPA076687) Datasheet (External Link) |
Vendor Page | Anti UNC5B pAb (ATL-HPA076687) |
Citations for Anti UNC5B pAb (ATL-HPA076687) – 1 Found |
Sawada, Junko; Hiraoka, Nobuyoshi; Qi, Rongsu; Jiang, Lu; Fournier-Goss, Ashley E; Yoshida, Masayuki; Kawashima, Hiroto; Komatsu, Masanobu. Molecular Signature of Tumor-Associated High Endothelial Venules That Can Predict Breast Cancer Survival. Cancer Immunology Research. 2022;10(4):468-481. PubMed |