Anti UNC5B pAb (ATL-HPA076687)
Atlas Antibodies
- Catalog No.:
- ATL-HPA076687-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: UNC5B
Alternative Gene Name: p53RDL1, UNC5H2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020099: 91%, ENSRNOG00000000567: 90%
Entrez Gene ID: 219699
Uniprot ID: Q8IZJ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SASLGSQQLLGLPRDPGSSVSGTFGCLGGRLSIPGTGVSLLVPNGAIPQGKFYEMYLLINKAESTLPLSE |
| Gene Sequence | SASLGSQQLLGLPRDPGSSVSGTFGCLGGRLSIPGTGVSLLVPNGAIPQGKFYEMYLLINKAESTLPLSE |
| Gene ID - Mouse | ENSMUSG00000020099 |
| Gene ID - Rat | ENSRNOG00000000567 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UNC5B pAb (ATL-HPA076687) | |
| Datasheet | Anti UNC5B pAb (ATL-HPA076687) Datasheet (External Link) |
| Vendor Page | Anti UNC5B pAb (ATL-HPA076687) at Atlas Antibodies |
| Documents & Links for Anti UNC5B pAb (ATL-HPA076687) | |
| Datasheet | Anti UNC5B pAb (ATL-HPA076687) Datasheet (External Link) |
| Vendor Page | Anti UNC5B pAb (ATL-HPA076687) |
| Citations for Anti UNC5B pAb (ATL-HPA076687) – 1 Found |
| Sawada, Junko; Hiraoka, Nobuyoshi; Qi, Rongsu; Jiang, Lu; Fournier-Goss, Ashley E; Yoshida, Masayuki; Kawashima, Hiroto; Komatsu, Masanobu. Molecular Signature of Tumor-Associated High Endothelial Venules That Can Predict Breast Cancer Survival. Cancer Immunology Research. 2022;10(4):468-481. PubMed |