Anti UNC5B pAb (ATL-HPA076687)

Atlas Antibodies

SKU: ATL-HPA076687-25

• 

Protein Description: unc-5 netrin receptor B
Gene Name: UNC5B
Alternative Gene Name: p53RDL1, UNC5H2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020099: 91%, ENSRNOG00000000567: 90%
Entrez Gene ID: 219699
Uniprot ID: Q8IZJ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SASLGSQQLLGLPRDPGSSVSGTFGCLGGRLSIPGTGVSLLVPNGAIPQGKFYEMYLLINKAESTLPLSE
• Gene Sequence: SASLGSQQLLGLPRDPGSSVSGTFGCLGGRLSIPGTGVSLLVPNGAIPQGKFYEMYLLINKAESTLPLSE
• Gene ID - Mouse: ENSMUSG00000020099
• Gene ID - Rat: ENSRNOG00000000567
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti UNC5B pAb (ATL-HPA076687) – 1 Found

Sawada, Junko; Hiraoka, Nobuyoshi; Qi, Rongsu; Jiang, Lu; Fournier-Goss, Ashley E; Yoshida, Masayuki; Kawashima, Hiroto; Komatsu, Masanobu. Molecular Signature of Tumor-Associated High Endothelial Venules That Can Predict Breast Cancer Survival. Cancer Immunology Research. 2022;10(4):468-481.