Anti UNC13D pAb (ATL-HPA073525)

Atlas Antibodies

Catalog No.:
ATL-HPA073525-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: unc-13 homolog D (C. elegans)
Gene Name: UNC13D
Alternative Gene Name: Munc13-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057948: 80%, ENSRNOG00000007439: 82%
Entrez Gene ID: 201294
Uniprot ID: Q70J99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TEWFHLKQQHHQPMVQGIPEAGKALLGLVQDVIGDLHQCQRTWDKIFHNTLKIHLFSMAFRELQWLVAKRVQDHTTVVGDVV
Gene Sequence TEWFHLKQQHHQPMVQGIPEAGKALLGLVQDVIGDLHQCQRTWDKIFHNTLKIHLFSMAFRELQWLVAKRVQDHTTVVGDVV
Gene ID - Mouse ENSMUSG00000057948
Gene ID - Rat ENSRNOG00000007439
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UNC13D pAb (ATL-HPA073525)
Datasheet Anti UNC13D pAb (ATL-HPA073525) Datasheet (External Link)
Vendor Page Anti UNC13D pAb (ATL-HPA073525) at Atlas Antibodies

Documents & Links for Anti UNC13D pAb (ATL-HPA073525)
Datasheet Anti UNC13D pAb (ATL-HPA073525) Datasheet (External Link)
Vendor Page Anti UNC13D pAb (ATL-HPA073525)