Anti UNC13B pAb (ATL-HPA062300)

Atlas Antibodies

Catalog No.: ATL-HPA062300-25

Protein Description: unc-13 homolog B (C. elegans)
Gene Name: UNC13B
Alternative Gene Name: hmunc13, UNC13, Unc13h2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028456: 86%, ENSRNOG00000008237: 84%
Entrez Gene ID: 10497
Uniprot ID: O14795
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPDLVLQKDHFLGPQESFPEENASSPFTQARAHWIRAVTKVRLQLQEIPDD
• Gene Sequence: PPDLVLQKDHFLGPQESFPEENASSPFTQARAHWIRAVTKVRLQLQEIPDD
• Gene ID - Mouse: ENSMUSG00000028456
• Gene ID - Rat: ENSRNOG00000008237
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.