Anti UMODL1 pAb (ATL-HPA067245)

Atlas Antibodies

Catalog No.:
ATL-HPA067245-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: uromodulin-like 1
Gene Name: UMODL1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054134: 60%, ENSRNOG00000001157: 59%
Entrez Gene ID: 89766
Uniprot ID: Q5DID0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CSGRELCANLEGSYWCVCHQEAPATSPRKLNLEWEDCPPVSDYVVLNVTSDSFQVSWRLNSTQNHTFHVRVYRGMELLRS
Gene Sequence CSGRELCANLEGSYWCVCHQEAPATSPRKLNLEWEDCPPVSDYVVLNVTSDSFQVSWRLNSTQNHTFHVRVYRGMELLRS
Gene ID - Mouse ENSMUSG00000054134
Gene ID - Rat ENSRNOG00000001157
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UMODL1 pAb (ATL-HPA067245)
Datasheet Anti UMODL1 pAb (ATL-HPA067245) Datasheet (External Link)
Vendor Page Anti UMODL1 pAb (ATL-HPA067245) at Atlas Antibodies

Documents & Links for Anti UMODL1 pAb (ATL-HPA067245)
Datasheet Anti UMODL1 pAb (ATL-HPA067245) Datasheet (External Link)
Vendor Page Anti UMODL1 pAb (ATL-HPA067245)