Anti ULK1 pAb (ATL-HPA063990)

Atlas Antibodies

Catalog No.: ATL-HPA063990-25

Protein Description: unc-51 like autophagy activating kinase 1
Gene Name: ULK1
Alternative Gene Name: ATG1, ATG1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029512: 87%, ENSRNOG00000037505: 87%
Entrez Gene ID: 8408
Uniprot ID: O75385
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TSGLGCRLHSAPNLSDLHVVRPKLPKPPTDPLGAVFSPPQASPPQPSHGLQSCRNLRGSPKLPDFLQRNP
• Gene Sequence: TSGLGCRLHSAPNLSDLHVVRPKLPKPPTDPLGAVFSPPQASPPQPSHGLQSCRNLRGSPKLPDFLQRNP
• Gene ID - Mouse: ENSMUSG00000029512
• Gene ID - Rat: ENSRNOG00000037505
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.