Anti ULBP3 pAb (ATL-HPA063007)

Atlas Antibodies

Catalog No.:
ATL-HPA063007-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: UL16 binding protein 3
Gene Name: ULBP3
Alternative Gene Name: RAET1N
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073947: 27%, ENSRNOG00000023659: 27%
Entrez Gene ID: 79465
Uniprot ID: Q9BZM4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEM
Gene Sequence AHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEM
Gene ID - Mouse ENSMUSG00000073947
Gene ID - Rat ENSRNOG00000023659
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ULBP3 pAb (ATL-HPA063007)
Datasheet Anti ULBP3 pAb (ATL-HPA063007) Datasheet (External Link)
Vendor Page Anti ULBP3 pAb (ATL-HPA063007) at Atlas Antibodies

Documents & Links for Anti ULBP3 pAb (ATL-HPA063007)
Datasheet Anti ULBP3 pAb (ATL-HPA063007) Datasheet (External Link)
Vendor Page Anti ULBP3 pAb (ATL-HPA063007)