Anti ULBP1 pAb (ATL-HPA071005)

Atlas Antibodies

Catalog No.:
ATL-HPA071005-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: UL16 binding protein 1
Gene Name: ULBP1
Alternative Gene Name: RAET1I
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052488: 28%, ENSRNOG00000033672: 29%
Entrez Gene ID: 80329
Uniprot ID: Q9BZM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPGTTQPK
Gene Sequence WTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPGTTQPK
Gene ID - Mouse ENSMUSG00000052488
Gene ID - Rat ENSRNOG00000033672
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ULBP1 pAb (ATL-HPA071005)
Datasheet Anti ULBP1 pAb (ATL-HPA071005) Datasheet (External Link)
Vendor Page Anti ULBP1 pAb (ATL-HPA071005) at Atlas Antibodies

Documents & Links for Anti ULBP1 pAb (ATL-HPA071005)
Datasheet Anti ULBP1 pAb (ATL-HPA071005) Datasheet (External Link)
Vendor Page Anti ULBP1 pAb (ATL-HPA071005)