Anti UHMK1 pAb (ATL-HPA071190)

Atlas Antibodies

SKU: ATL-HPA071190-25

• 

Protein Description: U2AF homology motif (UHM) kinase 1
Gene Name: UHMK1
Alternative Gene Name: KIS, Kist
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026667: 99%, ENSRNOG00000056731: 99%
Entrez Gene ID: 127933
Uniprot ID: Q8TAS1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NEEEYEDVVEDVKEECQKYGPVVSLLVPKENPGRGQVFVEYANAGDSKAAQKLLTGRMFDGKFVVATFYPLSAYKRGYLYQTLL
• Gene Sequence: NEEEYEDVVEDVKEECQKYGPVVSLLVPKENPGRGQVFVEYANAGDSKAAQKLLTGRMFDGKFVVATFYPLSAYKRGYLYQTLL
• Gene ID - Mouse: ENSMUSG00000026667
• Gene ID - Rat: ENSRNOG00000056731
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.