Anti UHMK1 pAb (ATL-HPA071190)

Atlas Antibodies

Catalog No.:
ATL-HPA071190-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: U2AF homology motif (UHM) kinase 1
Gene Name: UHMK1
Alternative Gene Name: KIS, Kist
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026667: 99%, ENSRNOG00000056731: 99%
Entrez Gene ID: 127933
Uniprot ID: Q8TAS1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NEEEYEDVVEDVKEECQKYGPVVSLLVPKENPGRGQVFVEYANAGDSKAAQKLLTGRMFDGKFVVATFYPLSAYKRGYLYQTLL
Gene Sequence NEEEYEDVVEDVKEECQKYGPVVSLLVPKENPGRGQVFVEYANAGDSKAAQKLLTGRMFDGKFVVATFYPLSAYKRGYLYQTLL
Gene ID - Mouse ENSMUSG00000026667
Gene ID - Rat ENSRNOG00000056731
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UHMK1 pAb (ATL-HPA071190)
Datasheet Anti UHMK1 pAb (ATL-HPA071190) Datasheet (External Link)
Vendor Page Anti UHMK1 pAb (ATL-HPA071190) at Atlas Antibodies

Documents & Links for Anti UHMK1 pAb (ATL-HPA071190)
Datasheet Anti UHMK1 pAb (ATL-HPA071190) Datasheet (External Link)
Vendor Page Anti UHMK1 pAb (ATL-HPA071190)