Anti UHMK1 pAb (ATL-HPA071190)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071190-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: UHMK1
Alternative Gene Name: KIS, Kist
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026667: 99%, ENSRNOG00000056731: 99%
Entrez Gene ID: 127933
Uniprot ID: Q8TAS1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NEEEYEDVVEDVKEECQKYGPVVSLLVPKENPGRGQVFVEYANAGDSKAAQKLLTGRMFDGKFVVATFYPLSAYKRGYLYQTLL |
| Gene Sequence | NEEEYEDVVEDVKEECQKYGPVVSLLVPKENPGRGQVFVEYANAGDSKAAQKLLTGRMFDGKFVVATFYPLSAYKRGYLYQTLL |
| Gene ID - Mouse | ENSMUSG00000026667 |
| Gene ID - Rat | ENSRNOG00000056731 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UHMK1 pAb (ATL-HPA071190) | |
| Datasheet | Anti UHMK1 pAb (ATL-HPA071190) Datasheet (External Link) |
| Vendor Page | Anti UHMK1 pAb (ATL-HPA071190) at Atlas Antibodies |
| Documents & Links for Anti UHMK1 pAb (ATL-HPA071190) | |
| Datasheet | Anti UHMK1 pAb (ATL-HPA071190) Datasheet (External Link) |
| Vendor Page | Anti UHMK1 pAb (ATL-HPA071190) |