Anti UGT8 pAb (ATL-HPA014405)

Atlas Antibodies

Catalog No.: ATL-HPA014405-25

Protein Description: UDP glycosyltransferase 8
Gene Name: UGT8
Alternative Gene Name: CGT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032854: 96%, ENSRNOG00000009345: 96%
Entrez Gene ID: 7368
Uniprot ID: Q16880
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SALHERGHHTVFLLSEGRDIAPSNHYSLQRYPGIFNSTTSDAFLQSKMRNIFSGRLTAIELFDILDHYTKNCDLMVGNHALIQGLKKEKFDLLLVDPNDMCGFVIAHLLGVKYAVFSTGLWYPAEVGAPA
• Gene Sequence: SALHERGHHTVFLLSEGRDIAPSNHYSLQRYPGIFNSTTSDAFLQSKMRNIFSGRLTAIELFDILDHYTKNCDLMVGNHALIQGLKKEKFDLLLVDPNDMCGFVIAHLLGVKYAVFSTGLWYPAEVGAPA
• Gene ID - Mouse: ENSMUSG00000032854
• Gene ID - Rat: ENSRNOG00000009345
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti UGT8 pAb (ATL-HPA014405) – 1 Found

Dzięgiel, P; Owczarek, T; Plazuk, E; Gomułkiewicz, A; Majchrzak, M; Podhorska-Okołów, M; Driouch, K; Lidereau, R; Ugorski, M. Ceramide galactosyltransferase (UGT8) is a molecular marker of breast cancer malignancy and lung metastases. British Journal Of Cancer. 2010;103(4):524-31.