Anti UGT3A1 pAb (ATL-HPA056290)

Atlas Antibodies

Catalog No.:
ATL-HPA056290-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: UDP glycosyltransferase 3 family, polypeptide A1
Gene Name: UGT3A1
Alternative Gene Name: FLJ34658
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049152: 45%, ENSRNOG00000046594: 27%
Entrez Gene ID: 133688
Uniprot ID: Q6NUS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSYQVIRWFSPEDHQKRIKKHFDSYIETALDGRKESEALVKLMEIFGTQCSYLLSRKDIM
Gene Sequence KSYQVIRWFSPEDHQKRIKKHFDSYIETALDGRKESEALVKLMEIFGTQCSYLLSRKDIM
Gene ID - Mouse ENSMUSG00000049152
Gene ID - Rat ENSRNOG00000046594
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UGT3A1 pAb (ATL-HPA056290)
Datasheet Anti UGT3A1 pAb (ATL-HPA056290) Datasheet (External Link)
Vendor Page Anti UGT3A1 pAb (ATL-HPA056290) at Atlas Antibodies

Documents & Links for Anti UGT3A1 pAb (ATL-HPA056290)
Datasheet Anti UGT3A1 pAb (ATL-HPA056290) Datasheet (External Link)
Vendor Page Anti UGT3A1 pAb (ATL-HPA056290)