Anti UGP2 pAb (ATL-HPA064836 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA064836-100
  • Immunohistochemical staining of human kidney, liver, rectum and skeletal muscle using Anti-UGP2 antibody HPA064836 (A) shows similar protein distribution across tissues to independent antibody HPA034696 (B).
  • Immunofluorescent staining of human cell line RH-30 shows localization to mitochondria & centrosome.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: UDP-glucose pyrophosphorylase 2
Gene Name: UGP2
Alternative Gene Name: UGP1, UGPP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001891: 98%, ENSRNOG00000008079: 99%
Entrez Gene ID: 7360
Uniprot ID: Q16851
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKRE
Gene Sequence IFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKRE
Gene ID - Mouse ENSMUSG00000001891
Gene ID - Rat ENSRNOG00000008079
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti UGP2 pAb (ATL-HPA064836 w/enhanced validation)
Datasheet Anti UGP2 pAb (ATL-HPA064836 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti UGP2 pAb (ATL-HPA064836 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti UGP2 pAb (ATL-HPA064836 w/enhanced validation)
Datasheet Anti UGP2 pAb (ATL-HPA064836 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti UGP2 pAb (ATL-HPA064836 w/enhanced validation)