Anti UGGT2 pAb (ATL-HPA047955)

Atlas Antibodies

Catalog No.:
ATL-HPA047955-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: UDP-glucose glycoprotein glucosyltransferase 2
Gene Name: UGGT2
Alternative Gene Name: FLJ10873, FLJ11485, HUGT2, MGC117360, MGC150689, MGC87276, UGCGL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042104: 66%, ENSRNOG00000014901: 39%
Entrez Gene ID: 55757
Uniprot ID: Q9NYU1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GEMGIVSNGRFLGPLDEDFYAEDFYLLEKITFSNLGEKIKGIVENMGINANNMSDFIMKVDALMSSVPKRASRYDVTFLRENHSVIKTNPQENDMFFNV
Gene Sequence GEMGIVSNGRFLGPLDEDFYAEDFYLLEKITFSNLGEKIKGIVENMGINANNMSDFIMKVDALMSSVPKRASRYDVTFLRENHSVIKTNPQENDMFFNV
Gene ID - Mouse ENSMUSG00000042104
Gene ID - Rat ENSRNOG00000014901
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UGGT2 pAb (ATL-HPA047955)
Datasheet Anti UGGT2 pAb (ATL-HPA047955) Datasheet (External Link)
Vendor Page Anti UGGT2 pAb (ATL-HPA047955) at Atlas Antibodies

Documents & Links for Anti UGGT2 pAb (ATL-HPA047955)
Datasheet Anti UGGT2 pAb (ATL-HPA047955) Datasheet (External Link)
Vendor Page Anti UGGT2 pAb (ATL-HPA047955)