Anti UFSP1 pAb (ATL-HPA027099)

Atlas Antibodies

Catalog No.: ATL-HPA027099-25

Protein Description: UFM1-specific peptidase 1 (non-functional)
Gene Name: UFSP1
Alternative Gene Name: UFSP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051502: 87%, ENSRNOG00000051006: 84%
Entrez Gene ID: 402682
Uniprot ID: Q6NVU6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GSRDWIGCVEASLCLAHFGGPQGRLCHVPRGVGLHGELERLYSHFAGGGGPVMVGGDADARS
• Gene Sequence: GSRDWIGCVEASLCLAHFGGPQGRLCHVPRGVGLHGELERLYSHFAGGGGPVMVGGDADARS
• Gene ID - Mouse: ENSMUSG00000051502
• Gene ID - Rat: ENSRNOG00000051006
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti UFSP1 pAb (ATL-HPA027099) – 1 Found

Millrine, David; Cummings, Thomas; Matthews, Stephen P; Peter, Joshua J; Magnussen, Helge M; Lange, Sven M; Macartney, Thomas; Lamoliatte, Frederic; Knebel, Axel; Kulathu, Yogesh. Human UFSP1 is an active protease that regulates UFM1 maturation and UFMylation. Cell Reports. 2022;40(5):111168.