Anti UEVLD pAb (ATL-HPA047134)

Atlas Antibodies

SKU: ATL-HPA047134-100

• 
• 
• 

Protein Description: UEV and lactate/malate dehyrogenase domains
Gene Name: UEVLD
Alternative Gene Name: Attp, UEV3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043262: 76%, ENSRNOG00000013624: 76%
Entrez Gene ID: 55293
Uniprot ID: Q8IX04
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GKEVWVIGEQGEDKVLTWSGQEEVVSHTSQVQLSNRAMELLRVKGQRSWSVGLSVADMVDSIVNNKKKVHSVSALA
• Gene Sequence: GKEVWVIGEQGEDKVLTWSGQEEVVSHTSQVQLSNRAMELLRVKGQRSWSVGLSVADMVDSIVNNKKKVHSVSALA
• Gene ID - Mouse: ENSMUSG00000043262
• Gene ID - Rat: ENSRNOG00000013624
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.