Anti UEVLD pAb (ATL-HPA047134)

Atlas Antibodies

Catalog No.:
ATL-HPA047134-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: UEV and lactate/malate dehyrogenase domains
Gene Name: UEVLD
Alternative Gene Name: Attp, UEV3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043262: 76%, ENSRNOG00000013624: 76%
Entrez Gene ID: 55293
Uniprot ID: Q8IX04
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GKEVWVIGEQGEDKVLTWSGQEEVVSHTSQVQLSNRAMELLRVKGQRSWSVGLSVADMVDSIVNNKKKVHSVSALA
Gene Sequence GKEVWVIGEQGEDKVLTWSGQEEVVSHTSQVQLSNRAMELLRVKGQRSWSVGLSVADMVDSIVNNKKKVHSVSALA
Gene ID - Mouse ENSMUSG00000043262
Gene ID - Rat ENSRNOG00000013624
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UEVLD pAb (ATL-HPA047134)
Datasheet Anti UEVLD pAb (ATL-HPA047134) Datasheet (External Link)
Vendor Page Anti UEVLD pAb (ATL-HPA047134) at Atlas Antibodies

Documents & Links for Anti UEVLD pAb (ATL-HPA047134)
Datasheet Anti UEVLD pAb (ATL-HPA047134) Datasheet (External Link)
Vendor Page Anti UEVLD pAb (ATL-HPA047134)