Anti UEVLD pAb (ATL-HPA047134)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047134-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: UEVLD
Alternative Gene Name: Attp, UEV3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043262: 76%, ENSRNOG00000013624: 76%
Entrez Gene ID: 55293
Uniprot ID: Q8IX04
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GKEVWVIGEQGEDKVLTWSGQEEVVSHTSQVQLSNRAMELLRVKGQRSWSVGLSVADMVDSIVNNKKKVHSVSALA |
| Gene Sequence | GKEVWVIGEQGEDKVLTWSGQEEVVSHTSQVQLSNRAMELLRVKGQRSWSVGLSVADMVDSIVNNKKKVHSVSALA |
| Gene ID - Mouse | ENSMUSG00000043262 |
| Gene ID - Rat | ENSRNOG00000013624 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UEVLD pAb (ATL-HPA047134) | |
| Datasheet | Anti UEVLD pAb (ATL-HPA047134) Datasheet (External Link) |
| Vendor Page | Anti UEVLD pAb (ATL-HPA047134) at Atlas Antibodies |
| Documents & Links for Anti UEVLD pAb (ATL-HPA047134) | |
| Datasheet | Anti UEVLD pAb (ATL-HPA047134) Datasheet (External Link) |
| Vendor Page | Anti UEVLD pAb (ATL-HPA047134) |