Anti UCKL1 pAb (ATL-HPA004769)

Atlas Antibodies

Catalog No.:
ATL-HPA004769-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: uridine-cytidine kinase 1-like 1
Gene Name: UCKL1
Alternative Gene Name: FLJ20517, URKL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000089917: 97%, ENSRNOG00000050277: 96%
Entrez Gene ID: 54963
Uniprot ID: Q9NWZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PWYNEHGTQSKEAFAIGLGGGSASGKTTVARMIIEALDVPWVVLLSMDSFYKVLTEQQQEQAAHNNFNFDHPDAFDFDLIISTLKKLKQGKSVKVPIYDFTTHSRKKDWKTLYGANVI
Gene Sequence PWYNEHGTQSKEAFAIGLGGGSASGKTTVARMIIEALDVPWVVLLSMDSFYKVLTEQQQEQAAHNNFNFDHPDAFDFDLIISTLKKLKQGKSVKVPIYDFTTHSRKKDWKTLYGANVI
Gene ID - Mouse ENSMUSG00000089917
Gene ID - Rat ENSRNOG00000050277
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UCKL1 pAb (ATL-HPA004769)
Datasheet Anti UCKL1 pAb (ATL-HPA004769) Datasheet (External Link)
Vendor Page Anti UCKL1 pAb (ATL-HPA004769) at Atlas Antibodies

Documents & Links for Anti UCKL1 pAb (ATL-HPA004769)
Datasheet Anti UCKL1 pAb (ATL-HPA004769) Datasheet (External Link)
Vendor Page Anti UCKL1 pAb (ATL-HPA004769)