Anti UCHL5 pAb (ATL-HPA075383)

Atlas Antibodies

Catalog No.: ATL-HPA075383-100

Protein Description: ubiquitin carboxyl-terminal hydrolase L5
Gene Name: UCHL5
Alternative Gene Name: CGI-70, INO80R, UCH37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018189: 95%, ENSRNOG00000003545: 96%
Entrez Gene ID: 51377
Uniprot ID: Q9Y5K5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDT
• Gene Sequence: MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDT
• Gene ID - Mouse: ENSMUSG00000018189
• Gene ID - Rat: ENSRNOG00000003545
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.