Anti UCHL5 pAb (ATL-HPA075383)

Atlas Antibodies

Catalog No.:
ATL-HPA075383-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: ubiquitin carboxyl-terminal hydrolase L5
Gene Name: UCHL5
Alternative Gene Name: CGI-70, INO80R, UCH37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018189: 95%, ENSRNOG00000003545: 96%
Entrez Gene ID: 51377
Uniprot ID: Q9Y5K5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDT
Gene Sequence MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDT
Gene ID - Mouse ENSMUSG00000018189
Gene ID - Rat ENSRNOG00000003545
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UCHL5 pAb (ATL-HPA075383)
Datasheet Anti UCHL5 pAb (ATL-HPA075383) Datasheet (External Link)
Vendor Page Anti UCHL5 pAb (ATL-HPA075383) at Atlas Antibodies

Documents & Links for Anti UCHL5 pAb (ATL-HPA075383)
Datasheet Anti UCHL5 pAb (ATL-HPA075383) Datasheet (External Link)
Vendor Page Anti UCHL5 pAb (ATL-HPA075383)