Anti UCHL5 pAb (ATL-HPA075383)
Atlas Antibodies
- Catalog No.:
- ATL-HPA075383-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: UCHL5
Alternative Gene Name: CGI-70, INO80R, UCH37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018189: 95%, ENSRNOG00000003545: 96%
Entrez Gene ID: 51377
Uniprot ID: Q9Y5K5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDT |
Gene Sequence | MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDT |
Gene ID - Mouse | ENSMUSG00000018189 |
Gene ID - Rat | ENSRNOG00000003545 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti UCHL5 pAb (ATL-HPA075383) | |
Datasheet | Anti UCHL5 pAb (ATL-HPA075383) Datasheet (External Link) |
Vendor Page | Anti UCHL5 pAb (ATL-HPA075383) at Atlas Antibodies |
Documents & Links for Anti UCHL5 pAb (ATL-HPA075383) | |
Datasheet | Anti UCHL5 pAb (ATL-HPA075383) Datasheet (External Link) |
Vendor Page | Anti UCHL5 pAb (ATL-HPA075383) |