Anti UCHL1 pAb (ATL-HPA005993 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA005993-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: UCHL1
Alternative Gene Name: PARK5, PGP9.5, Uch-L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029223: 97%, ENSRNOG00000002343: 97%
Entrez Gene ID: 7345
Uniprot ID: P09936
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVAL |
| Gene Sequence | QEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVAL |
| Gene ID - Mouse | ENSMUSG00000029223 |
| Gene ID - Rat | ENSRNOG00000002343 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UCHL1 pAb (ATL-HPA005993 w/enhanced validation) | |
| Datasheet | Anti UCHL1 pAb (ATL-HPA005993 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti UCHL1 pAb (ATL-HPA005993 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti UCHL1 pAb (ATL-HPA005993 w/enhanced validation) | |
| Datasheet | Anti UCHL1 pAb (ATL-HPA005993 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti UCHL1 pAb (ATL-HPA005993 w/enhanced validation) |
| Citations for Anti UCHL1 pAb (ATL-HPA005993 w/enhanced validation) – 21 Found |
| Chen, Ying; Cha, Zhanshan; Fang, Wenzheng; Qian, Baohua; Yu, Wenlong; Li, Wenfeng; Yu, Guanzhen; Gao, Yong. The prognostic potential and oncogenic effects of PRR11 expression in hilar cholangiocarcinoma. Oncotarget. 2015;6(24):20419-33. PubMed |
| Nakashima, Ryota; Goto, Yoko; Koyasu, Sho; Kobayashi, Minoru; Morinibu, Akiyo; Yoshimura, Michio; Hiraoka, Masahiro; Hammond, Ester M; Harada, Hiroshi. UCHL1-HIF-1 axis-mediated antioxidant property of cancer cells as a therapeutic target for radiosensitization. Scientific Reports. 2017;7(1):6879. PubMed |
| Strange, Daniel P; Jiyarom, Boonyanudh; Pourhabibi Zarandi, Nima; Xie, Xuping; Baker, Coleman; Sadri-Ardekani, Hooman; Shi, Pei-Yong; Verma, Saguna. Axl Promotes Zika Virus Entry and Modulates the Antiviral State of Human Sertoli Cells. Mbio. 2019;10(4) PubMed |
| Ireland, Abbie S; Micinski, Alexi M; Kastner, David W; Guo, Bingqian; Wait, Sarah J; Spainhower, Kyle B; Conley, Christopher C; Chen, Opal S; Guthrie, Matthew R; Soltero, Danny; Qiao, Yi; Huang, Xiaomeng; Tarapcsák, Szabolcs; Devarakonda, Siddhartha; Chalishazar, Milind D; Gertz, Jason; Moser, Justin C; Marth, Gabor; Puri, Sonam; Witt, Benjamin L; Spike, Benjamin T; Oliver, Trudy G. MYC Drives Temporal Evolution of Small Cell Lung Cancer Subtypes by Reprogramming Neuroendocrine Fate. Cancer Cell. 2020;38(1):60-78.e12. PubMed |
| Foggetti, Giorgia; Li, Chuan; Cai, Hongchen; Hellyer, Jessica A; Lin, Wen-Yang; Ayeni, Deborah; Hastings, Katherine; Choi, Jungmin; Wurtz, Anna; Andrejka, Laura; Maghini, Dylan G; Rashleigh, Nicholas; Levy, Stellar; Homer, Robert; Gettinger, Scott N; Diehn, Maximilian; Wakelee, Heather A; Petrov, Dmitri A; Winslow, Monte M; Politi, Katerina. Genetic Determinants of EGFR-Driven Lung Cancer Growth and Therapeutic Response In Vivo. Cancer Discovery. 2021;11(7):1736-1753. PubMed |
| Olsen, Rachelle R; Ireland, Abbie S; Kastner, David W; Groves, Sarah M; Spainhower, Kyle B; Pozo, Karine; Kelenis, Demetra P; Whitney, Christopher P; Guthrie, Matthew R; Wait, Sarah J; Soltero, Danny; Witt, Benjamin L; Quaranta, Vito; Johnson, Jane E; Oliver, Trudy G. ASCL1 represses a SOX9(+) neural crest stem-like state in small cell lung cancer. Genes & Development. 2021;35(11-12):847-869. PubMed |
| Davies, Christopher W; Vidal, Simon E; Phu, Lilian; Sudhamsu, Jawahar; Hinkle, Trent B; Chan Rosenberg, Scott; Schumacher, Frances-Rose; Zeng, Yi Jimmy; Schwerdtfeger, Carsten; Peterson, Andrew S; Lill, Jennie R; Rose, Christopher M; Shaw, Andrey S; Wertz, Ingrid E; Kirkpatrick, Donald S; Koerber, James T. Antibody toolkit reveals N-terminally ubiquitinated substrates of UBE2W. Nature Communications. 2021;12(1):4608. PubMed |
| Shue, Yan Ting; Drainas, Alexandros P; Li, Nancy Yanzhe; Pearsall, Sarah M; Morgan, Derrick; Sinnott-Armstrong, Nasa; Hipkins, Susan Q; Coles, Garry L; Lim, Jing Shan; Oro, Anthony E; Simpson, Kathryn L; Dive, Caroline; Sage, Julien. A conserved YAP/Notch/REST network controls the neuroendocrine cell fate in the lungs. Nature Communications. 2022;13(1):2690. PubMed |
| Lindskog, Cecilia; Asplund, Anna; Engkvist, Margareta; Uhlen, Mathias; Korsgren, Olle; Ponten, Fredrik. Antibody-based proteomics for discovery and exploration of proteins expressed in pancreatic islets. Discovery Medicine. 2010;9(49):565-78. PubMed |
| Yang, Honghong; Zhang, Chunhong; Fang, Shan; Ou, Rongying; Li, Wenfeng; Xu, Yunsheng. UCH-LI acts as a novel prognostic biomarker in gastric cardiac adenocarcinoma. International Journal Of Clinical And Experimental Pathology. 8(11):13957-67. PubMed |
| Kim, Dong-Wook; Wu, Nan; Kim, Young-Chul; Cheng, Pei Feng; Basom, Ryan; Kim, Dongkyoon; Dunn, Colin T; Lee, Anastasia Y; Kim, Keebeom; Lee, Chang Sup; Singh, Andrew; Gazdar, Adi F; Harris, Chris R; Eisenman, Robert N; Park, Kwon-Sik; MacPherson, David. Genetic requirement for Mycl and efficacy of RNA Pol I inhibition in mouse models of small cell lung cancer. Genes & Development. 2016;30(11):1289-99. PubMed |
| Zeng, W; Alpaugh, W; Stefanovski, D; Schlingmann, K; Dobrinski, I; Turner, R M. Xenografting of isolated equine (Equus caballus) testis cells results in de novo morphogenesis of seminiferous tubules but not spermatogenesis. Andrology. 2017;5(2):336-346. PubMed |
| Lim, Jing Shan; Ibaseta, Alvaro; Fischer, Marcus M; Cancilla, Belinda; O'Young, Gilbert; Cristea, Sandra; Luca, Vincent C; Yang, Dian; Jahchan, Nadine S; Hamard, Cécile; Antoine, Martine; Wislez, Marie; Kong, Christina; Cain, Jennifer; Liu, Yu-Wang; Kapoun, Ann M; Garcia, K Christopher; Hoey, Timothy; Murriel, Christopher L; Sage, Julien. Intratumoural heterogeneity generated by Notch signalling promotes small-cell lung cancer. Nature. 2017;545(7654):360-364. PubMed |
| Jia, Deshui; Augert, Arnaud; Kim, Dong-Wook; Eastwood, Emily; Wu, Nan; Ibrahim, Ali H; Kim, Kee-Beom; Dunn, Colin T; Pillai, Smitha P S; Gazdar, Adi F; Bolouri, Hamid; Park, Kwon-Sik; MacPherson, David. Crebbp Loss Drives Small Cell Lung Cancer and Increases Sensitivity to HDAC Inhibition. Cancer Discovery. 2018;8(11):1422-1437. PubMed |
| Yang, Dian; Denny, Sarah K; Greenside, Peyton G; Chaikovsky, Andrea C; Brady, Jennifer J; Ouadah, Youcef; Granja, Jeffrey M; Jahchan, Nadine S; Lim, Jing Shan; Kwok, Shirley; Kong, Christina S; Berghoff, Anna S; Schmitt, Anna; Reinhardt, H Christian; Park, Kwon-Sik; Preusser, Matthias; Kundaje, Anshul; Greenleaf, William J; Sage, Julien; Winslow, Monte M. Intertumoral Heterogeneity in SCLC Is Influenced by the Cell Type of Origin. Cancer Discovery. 2018;8(10):1316-1331. PubMed |
| Yang, Dian; Qu, Fangfei; Cai, Hongchen; Chuang, Chen-Hua; Lim, Jing Shan; Jahchan, Nadine; Grüner, Barbara M; S Kuo, Christin; Kong, Christina; Oudin, Madeleine J; Winslow, Monte M; Sage, Julien. Axon-like protrusions promote small cell lung cancer migration and metastasis. Elife. 2019;8( 31833833) PubMed |
| Kwan, Suet-Ying; Au-Yeung, Chi-Lam; Yeung, Tsz-Lun; Rynne-Vidal, Angela; Wong, Kwong-Kwok; Risinger, John I; Lin, Hui-Kuan; Schmandt, Rosemarie E; Yates, Melinda S; Mok, Samuel C; Lu, Karen H. Ubiquitin Carboxyl-Terminal Hydrolase L1 (UCHL1) Promotes Uterine Serous Cancer Cell Proliferation and Cell Cycle Progression. Cancers. 2020;12(1) PubMed |
| Jin, Yan; Zhou, Hong; Gong, Lei; Xia, Jiazeng; Yu, Guanzhen; Chen, Yigang. Prognostic potential and oncogenic effects of UCH-L1 expression in hilar cholangiocarcinoma. International Journal Of Clinical And Experimental Pathology. 10(11):10802-10811. PubMed |
| Kooij, Raymond; Liu, Sijia; Sapmaz, Aysegul; Xin, Bo-Tao; Janssen, George M C; van Veelen, Peter A; Ovaa, Huib; Dijke, Peter Ten; Geurink, Paul P. Small-Molecule Activity-Based Probe for Monitoring Ubiquitin C-Terminal Hydrolase L1 (UCHL1) Activity in Live Cells and Zebrafish Embryos. Journal Of The American Chemical Society. 2020;142(39):16825-16841. PubMed |
| Yousefi, Maryam; Boross, Gábor; Weiss, Carly; Murray, Christopher W; Hebert, Jess D; Cai, Hongchen; Ashkin, Emily L; Karmakar, Saswati; Andrejka, Laura; Chen, Leo; Wang, Minwei; Tsai, Min K; Lin, Wen-Yang; Li, Chuan; Yakhchalian, Pegah; Colón, Caterina I; Chew, Su-Kit; Chu, Pauline; Swanton, Charles; Kunder, Christian A; Petrov, Dmitri A; Winslow, Monte M. Combinatorial Inactivation of Tumor Suppressors Efficiently Initiates Lung Adenocarcinoma with Therapeutic Vulnerabilities. Cancer Research. 2022;82(8):1589-1602. PubMed |
| Lee, Myung Chang; Cai, Hongchen; Murray, Christopher W; Li, Chuan; Shue, Yan Ting; Andrejka, Laura; He, Andy L; Holzem, Alessandra M E; Drainas, Alexandros P; Ko, Julie H; Coles, Garry L; Kong, Christina; Zhu, Shirley; Zhu, ChunFang; Wang, Jason; van de Rijn, Matt; Petrov, Dmitri A; Winslow, Monte M; Sage, Julien. A multiplexed in vivo approach to identify driver genes in small cell lung cancer. Cell Reports. 2023;42(1):111990. PubMed |