Anti UBXN8 pAb (ATL-HPA077538)

Atlas Antibodies

Catalog No.:
ATL-HPA077538-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: UBX domain protein 8
Gene Name: UBXN8
Alternative Gene Name: D8S2298E, REP8, UBXD6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052906: 76%, ENSRNOG00000015109: 79%
Entrez Gene ID: 7993
Uniprot ID: O00124
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSPQVYLKEEEEKNEKRQKLVRKKQQEAQGEKASRYIENVLKPHQEMKLRKLEERFYQMTGEAWKLSSGHK
Gene Sequence KSPQVYLKEEEEKNEKRQKLVRKKQQEAQGEKASRYIENVLKPHQEMKLRKLEERFYQMTGEAWKLSSGHK
Gene ID - Mouse ENSMUSG00000052906
Gene ID - Rat ENSRNOG00000015109
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBXN8 pAb (ATL-HPA077538)
Datasheet Anti UBXN8 pAb (ATL-HPA077538) Datasheet (External Link)
Vendor Page Anti UBXN8 pAb (ATL-HPA077538) at Atlas Antibodies

Documents & Links for Anti UBXN8 pAb (ATL-HPA077538)
Datasheet Anti UBXN8 pAb (ATL-HPA077538) Datasheet (External Link)
Vendor Page Anti UBXN8 pAb (ATL-HPA077538)