Anti UBXN8 pAb (ATL-HPA077538)
Atlas Antibodies
- Catalog No.:
- ATL-HPA077538-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: UBXN8
Alternative Gene Name: D8S2298E, REP8, UBXD6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052906: 76%, ENSRNOG00000015109: 79%
Entrez Gene ID: 7993
Uniprot ID: O00124
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KSPQVYLKEEEEKNEKRQKLVRKKQQEAQGEKASRYIENVLKPHQEMKLRKLEERFYQMTGEAWKLSSGHK |
| Gene Sequence | KSPQVYLKEEEEKNEKRQKLVRKKQQEAQGEKASRYIENVLKPHQEMKLRKLEERFYQMTGEAWKLSSGHK |
| Gene ID - Mouse | ENSMUSG00000052906 |
| Gene ID - Rat | ENSRNOG00000015109 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UBXN8 pAb (ATL-HPA077538) | |
| Datasheet | Anti UBXN8 pAb (ATL-HPA077538) Datasheet (External Link) |
| Vendor Page | Anti UBXN8 pAb (ATL-HPA077538) at Atlas Antibodies |
| Documents & Links for Anti UBXN8 pAb (ATL-HPA077538) | |
| Datasheet | Anti UBXN8 pAb (ATL-HPA077538) Datasheet (External Link) |
| Vendor Page | Anti UBXN8 pAb (ATL-HPA077538) |