Anti UBXN7 pAb (ATL-HPA049442 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA049442-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: UBX domain protein 7
Gene Name: UBXN7
Alternative Gene Name: KIAA0794, UBXD7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053774: 100%, ENSRNOG00000046969: 100%
Entrez Gene ID: 26043
Uniprot ID: O94888
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FGAPKRRRPARSIFDGFRDFQTETIRQEQELRNGGAIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFACQCLNRDVWSNEAVK
Gene Sequence FGAPKRRRPARSIFDGFRDFQTETIRQEQELRNGGAIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFACQCLNRDVWSNEAVK
Gene ID - Mouse ENSMUSG00000053774
Gene ID - Rat ENSRNOG00000046969
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBXN7 pAb (ATL-HPA049442 w/enhanced validation)
Datasheet Anti UBXN7 pAb (ATL-HPA049442 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti UBXN7 pAb (ATL-HPA049442 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti UBXN7 pAb (ATL-HPA049442 w/enhanced validation)
Datasheet Anti UBXN7 pAb (ATL-HPA049442 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti UBXN7 pAb (ATL-HPA049442 w/enhanced validation)