Anti UBXN6 pAb (ATL-HPA061872)

Atlas Antibodies

Catalog No.:
ATL-HPA061872-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: UBX domain protein 6
Gene Name: UBXN6
Alternative Gene Name: UBXD1, UBXDC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019578: 79%, ENSRNOG00000048509: 79%
Entrez Gene ID: 80700
Uniprot ID: Q9BZV1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KFFQEFKADIKFKSAGPGQKLKESVGEKAHKEKPNQPAPRPPRQGPTNEAQMAAAAALARLEQKQSRA
Gene Sequence KFFQEFKADIKFKSAGPGQKLKESVGEKAHKEKPNQPAPRPPRQGPTNEAQMAAAAALARLEQKQSRA
Gene ID - Mouse ENSMUSG00000019578
Gene ID - Rat ENSRNOG00000048509
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBXN6 pAb (ATL-HPA061872)
Datasheet Anti UBXN6 pAb (ATL-HPA061872) Datasheet (External Link)
Vendor Page Anti UBXN6 pAb (ATL-HPA061872) at Atlas Antibodies

Documents & Links for Anti UBXN6 pAb (ATL-HPA061872)
Datasheet Anti UBXN6 pAb (ATL-HPA061872) Datasheet (External Link)
Vendor Page Anti UBXN6 pAb (ATL-HPA061872)