Anti UBXN2A pAb (ATL-HPA069096)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069096-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: UBXN2A
Alternative Gene Name: UBXD4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020634: 98%, ENSRNOG00000004950: 96%
Entrez Gene ID: 165324
Uniprot ID: P68543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NGFTVNDDFRSYSDGASQQFLNSIKKGELPSELQGIFDKEEVDVKVEDKK |
| Gene Sequence | NGFTVNDDFRSYSDGASQQFLNSIKKGELPSELQGIFDKEEVDVKVEDKK |
| Gene ID - Mouse | ENSMUSG00000020634 |
| Gene ID - Rat | ENSRNOG00000004950 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UBXN2A pAb (ATL-HPA069096) | |
| Datasheet | Anti UBXN2A pAb (ATL-HPA069096) Datasheet (External Link) |
| Vendor Page | Anti UBXN2A pAb (ATL-HPA069096) at Atlas Antibodies |
| Documents & Links for Anti UBXN2A pAb (ATL-HPA069096) | |
| Datasheet | Anti UBXN2A pAb (ATL-HPA069096) Datasheet (External Link) |
| Vendor Page | Anti UBXN2A pAb (ATL-HPA069096) |