Anti UBXN2A pAb (ATL-HPA069096)

Atlas Antibodies

Catalog No.:
ATL-HPA069096-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: UBX domain protein 2A
Gene Name: UBXN2A
Alternative Gene Name: UBXD4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020634: 98%, ENSRNOG00000004950: 96%
Entrez Gene ID: 165324
Uniprot ID: P68543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NGFTVNDDFRSYSDGASQQFLNSIKKGELPSELQGIFDKEEVDVKVEDKK
Gene Sequence NGFTVNDDFRSYSDGASQQFLNSIKKGELPSELQGIFDKEEVDVKVEDKK
Gene ID - Mouse ENSMUSG00000020634
Gene ID - Rat ENSRNOG00000004950
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBXN2A pAb (ATL-HPA069096)
Datasheet Anti UBXN2A pAb (ATL-HPA069096) Datasheet (External Link)
Vendor Page Anti UBXN2A pAb (ATL-HPA069096) at Atlas Antibodies

Documents & Links for Anti UBXN2A pAb (ATL-HPA069096)
Datasheet Anti UBXN2A pAb (ATL-HPA069096) Datasheet (External Link)
Vendor Page Anti UBXN2A pAb (ATL-HPA069096)