Anti UBXN1 pAb (ATL-HPA076932)

Atlas Antibodies

Catalog No.:
ATL-HPA076932-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: UBX domain protein 1
Gene Name: UBXN1
Alternative Gene Name: 2B28, LOC51035, SAKS1, UBXD10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071655: 91%, ENSRNOG00000019666: 87%
Entrez Gene ID: 51035
Uniprot ID: Q04323
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KAEELAARQRVREKIERDKAERAKKYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDG
Gene Sequence KAEELAARQRVREKIERDKAERAKKYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDG
Gene ID - Mouse ENSMUSG00000071655
Gene ID - Rat ENSRNOG00000019666
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBXN1 pAb (ATL-HPA076932)
Datasheet Anti UBXN1 pAb (ATL-HPA076932) Datasheet (External Link)
Vendor Page Anti UBXN1 pAb (ATL-HPA076932) at Atlas Antibodies

Documents & Links for Anti UBXN1 pAb (ATL-HPA076932)
Datasheet Anti UBXN1 pAb (ATL-HPA076932) Datasheet (External Link)
Vendor Page Anti UBXN1 pAb (ATL-HPA076932)