Anti UBXN1 pAb (ATL-HPA076932)
Atlas Antibodies
- Catalog No.:
- ATL-HPA076932-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: UBXN1
Alternative Gene Name: 2B28, LOC51035, SAKS1, UBXD10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071655: 91%, ENSRNOG00000019666: 87%
Entrez Gene ID: 51035
Uniprot ID: Q04323
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KAEELAARQRVREKIERDKAERAKKYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDG |
| Gene Sequence | KAEELAARQRVREKIERDKAERAKKYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDG |
| Gene ID - Mouse | ENSMUSG00000071655 |
| Gene ID - Rat | ENSRNOG00000019666 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UBXN1 pAb (ATL-HPA076932) | |
| Datasheet | Anti UBXN1 pAb (ATL-HPA076932) Datasheet (External Link) |
| Vendor Page | Anti UBXN1 pAb (ATL-HPA076932) at Atlas Antibodies |
| Documents & Links for Anti UBXN1 pAb (ATL-HPA076932) | |
| Datasheet | Anti UBXN1 pAb (ATL-HPA076932) Datasheet (External Link) |
| Vendor Page | Anti UBXN1 pAb (ATL-HPA076932) |