Anti UBXN1 pAb (ATL-HPA076932)

Atlas Antibodies

Catalog No.: ATL-HPA076932-25

Protein Description: UBX domain protein 1
Gene Name: UBXN1
Alternative Gene Name: 2B28, LOC51035, SAKS1, UBXD10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071655: 91%, ENSRNOG00000019666: 87%
Entrez Gene ID: 51035
Uniprot ID: Q04323
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KAEELAARQRVREKIERDKAERAKKYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDG
• Gene Sequence: KAEELAARQRVREKIERDKAERAKKYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDG
• Gene ID - Mouse: ENSMUSG00000071655
• Gene ID - Rat: ENSRNOG00000019666
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.