Anti UBTF pAb (ATL-HPA006385 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA006385-25

Protein Description: upstream binding transcription factor, RNA polymerase I
Gene Name: UBTF
Alternative Gene Name: NOR-90, UBF, UBF1, UBF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020923: 98%, ENSRNOG00000020937: 98%
Entrez Gene ID: 7343
Uniprot ID: P17480
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQATSPASKKPAQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSEKKK
• Gene Sequence: WKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQATSPASKKPAQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSEKKK
• Gene ID - Mouse: ENSMUSG00000020923
• Gene ID - Rat: ENSRNOG00000020937
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti UBTF pAb (ATL-HPA006385 w/enhanced validation) – 2 Found

Bennett, Alexis H; O'Donohue, Marie-Francoise; Gundry, Stacey R; Chan, Aye T; Widrick, Jeffrey; Draper, Isabelle; Chakraborty, Anirban; Zhou, Yi; Zon, Leonard I; Gleizes, Pierre-Emmanuel; Beggs, Alan H; Gupta, Vandana A. RNA helicase, DDX27 regulates skeletal muscle growth and regeneration by modulation of translational processes. Plos Genetics. 2018;14(3):e1007226. 

Sobol, Margarita; Yildirim, Sukriye; Philimonenko, Vlada V; Marášek, Pavel; Castaño, Enrique; Hozák, Pavel. UBF complexes with phosphatidylinositol 4,5-bisphosphate in nucleolar organizer regions regardless of ongoing RNA polymerase I activity. Nucleus (Austin, Tex.). 2013;4(6):478-86.