Anti UBR7 pAb (ATL-HPA000861)

Atlas Antibodies

Catalog No.:
ATL-HPA000861-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ubiquitin protein ligase E3 component n-recognin 7 (putative)
Gene Name: UBR7
Alternative Gene Name: C14orf130
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041712: 94%, ENSRNOG00000008108: 96%
Entrez Gene ID: 55148
Uniprot ID: Q8N806
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RQSELEPVVSLVDVLEEDEELENEACAVLGGSDSEKCSYSQGSVKRQALYACSTCTPEGEEPAGICLACSYECHGSHKLFELYTKRNFRCDCGNSKFKNLECKLLPDKAKVNSGNKYNDNFFGLYCICKRPYPDPEDEI
Gene Sequence RQSELEPVVSLVDVLEEDEELENEACAVLGGSDSEKCSYSQGSVKRQALYACSTCTPEGEEPAGICLACSYECHGSHKLFELYTKRNFRCDCGNSKFKNLECKLLPDKAKVNSGNKYNDNFFGLYCICKRPYPDPEDEI
Gene ID - Mouse ENSMUSG00000041712
Gene ID - Rat ENSRNOG00000008108
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBR7 pAb (ATL-HPA000861)
Datasheet Anti UBR7 pAb (ATL-HPA000861) Datasheet (External Link)
Vendor Page Anti UBR7 pAb (ATL-HPA000861) at Atlas Antibodies

Documents & Links for Anti UBR7 pAb (ATL-HPA000861)
Datasheet Anti UBR7 pAb (ATL-HPA000861) Datasheet (External Link)
Vendor Page Anti UBR7 pAb (ATL-HPA000861)
Citations for Anti UBR7 pAb (ATL-HPA000861) – 1 Found
Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51.  PubMed