Anti UBR5 pAb (ATL-HPA053688)

Atlas Antibodies

Catalog No.: ATL-HPA053688-25

Protein Description: ubiquitin protein ligase E3 component n-recognin 5
Gene Name: UBR5
Alternative Gene Name: DD5, EDD, EDD1, HYD, KIAA0896
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037487: 97%, ENSRNOG00000006816: 60%
Entrez Gene ID: 51366
Uniprot ID: O95071
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GSTSKEGEPNLDKKNTPVQSPVSLGEDLQWWPDKDGTKFICIGALYSELLAVSSKGELYQWKWSESEPYRNAQNPSLHHPRATFLGLTNEKI
• Gene Sequence: GSTSKEGEPNLDKKNTPVQSPVSLGEDLQWWPDKDGTKFICIGALYSELLAVSSKGELYQWKWSESEPYRNAQNPSLHHPRATFLGLTNEKI
• Gene ID - Mouse: ENSMUSG00000037487
• Gene ID - Rat: ENSRNOG00000006816
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.