Anti UBR5 pAb (ATL-HPA053688)

Atlas Antibodies

Catalog No.:
ATL-HPA053688-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: ubiquitin protein ligase E3 component n-recognin 5
Gene Name: UBR5
Alternative Gene Name: DD5, EDD, EDD1, HYD, KIAA0896
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037487: 97%, ENSRNOG00000006816: 60%
Entrez Gene ID: 51366
Uniprot ID: O95071
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSTSKEGEPNLDKKNTPVQSPVSLGEDLQWWPDKDGTKFICIGALYSELLAVSSKGELYQWKWSESEPYRNAQNPSLHHPRATFLGLTNEKI
Gene Sequence GSTSKEGEPNLDKKNTPVQSPVSLGEDLQWWPDKDGTKFICIGALYSELLAVSSKGELYQWKWSESEPYRNAQNPSLHHPRATFLGLTNEKI
Gene ID - Mouse ENSMUSG00000037487
Gene ID - Rat ENSRNOG00000006816
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBR5 pAb (ATL-HPA053688)
Datasheet Anti UBR5 pAb (ATL-HPA053688) Datasheet (External Link)
Vendor Page Anti UBR5 pAb (ATL-HPA053688) at Atlas Antibodies

Documents & Links for Anti UBR5 pAb (ATL-HPA053688)
Datasheet Anti UBR5 pAb (ATL-HPA053688) Datasheet (External Link)
Vendor Page Anti UBR5 pAb (ATL-HPA053688)