Anti UBR1 pAb (ATL-HPA038839)

Atlas Antibodies

Catalog No.:
ATL-HPA038839-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ubiquitin protein ligase E3 component n-recognin 1
Gene Name: UBR1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027272: 92%, ENSRNOG00000037207: 74%
Entrez Gene ID: 197131
Uniprot ID: Q8IWV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EYLCPLCKSLCNTVIPIIPLQPQKINSENADALAQLLTLARWIQTVLARISGYNIRHAKGENPIPIFFNQGMGDSTLEFHSILSFGVESSIKYSNSIKEMVILFATTIYRIGLKVPPD
Gene Sequence EYLCPLCKSLCNTVIPIIPLQPQKINSENADALAQLLTLARWIQTVLARISGYNIRHAKGENPIPIFFNQGMGDSTLEFHSILSFGVESSIKYSNSIKEMVILFATTIYRIGLKVPPD
Gene ID - Mouse ENSMUSG00000027272
Gene ID - Rat ENSRNOG00000037207
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBR1 pAb (ATL-HPA038839)
Datasheet Anti UBR1 pAb (ATL-HPA038839) Datasheet (External Link)
Vendor Page Anti UBR1 pAb (ATL-HPA038839) at Atlas Antibodies

Documents & Links for Anti UBR1 pAb (ATL-HPA038839)
Datasheet Anti UBR1 pAb (ATL-HPA038839) Datasheet (External Link)
Vendor Page Anti UBR1 pAb (ATL-HPA038839)