Anti UBR1 pAb (ATL-HPA038839)

Atlas Antibodies

Catalog No.: ATL-HPA038839-25

Protein Description: ubiquitin protein ligase E3 component n-recognin 1
Gene Name: UBR1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027272: 92%, ENSRNOG00000037207: 74%
Entrez Gene ID: 197131
Uniprot ID: Q8IWV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EYLCPLCKSLCNTVIPIIPLQPQKINSENADALAQLLTLARWIQTVLARISGYNIRHAKGENPIPIFFNQGMGDSTLEFHSILSFGVESSIKYSNSIKEMVILFATTIYRIGLKVPPD
• Gene Sequence: EYLCPLCKSLCNTVIPIIPLQPQKINSENADALAQLLTLARWIQTVLARISGYNIRHAKGENPIPIFFNQGMGDSTLEFHSILSFGVESSIKYSNSIKEMVILFATTIYRIGLKVPPD
• Gene ID - Mouse: ENSMUSG00000027272
• Gene ID - Rat: ENSRNOG00000037207
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.