Anti UBQLN4 pAb (ATL-HPA061797)

Atlas Antibodies

Catalog No.:
ATL-HPA061797-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ubiquilin 4
Gene Name: UBQLN4
Alternative Gene Name: A1U, C1orf6, UBIN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008604: 100%, ENSRNOG00000019933: 100%
Entrez Gene ID: 56893
Uniprot ID: Q9NRR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EGTGGSGTSQVHPTVSNPFGINAASLGSGMFNSPEMQALLQQISEN
Gene Sequence EGTGGSGTSQVHPTVSNPFGINAASLGSGMFNSPEMQALLQQISEN
Gene ID - Mouse ENSMUSG00000008604
Gene ID - Rat ENSRNOG00000019933
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBQLN4 pAb (ATL-HPA061797)
Datasheet Anti UBQLN4 pAb (ATL-HPA061797) Datasheet (External Link)
Vendor Page Anti UBQLN4 pAb (ATL-HPA061797) at Atlas Antibodies

Documents & Links for Anti UBQLN4 pAb (ATL-HPA061797)
Datasheet Anti UBQLN4 pAb (ATL-HPA061797) Datasheet (External Link)
Vendor Page Anti UBQLN4 pAb (ATL-HPA061797)