Anti UBN2 pAb (ATL-HPA020124)

Atlas Antibodies

Catalog No.:
ATL-HPA020124-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ubinuclein 2
Gene Name: UBN2
Alternative Gene Name: FLJ25778, KIAA2030
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038538: 93%, ENSRNOG00000005564: 92%
Entrez Gene ID: 254048
Uniprot ID: Q6ZU65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PTLNLLPSSRTSGLPPTKNLQAPSKLTNSSSTGTVGKNSLSGIAMNVPASRGSNLNSSGANRTSLSGGTGSGTQGATKPLSTPHRPSTASGSSVVTASVQ
Gene Sequence PTLNLLPSSRTSGLPPTKNLQAPSKLTNSSSTGTVGKNSLSGIAMNVPASRGSNLNSSGANRTSLSGGTGSGTQGATKPLSTPHRPSTASGSSVVTASVQ
Gene ID - Mouse ENSMUSG00000038538
Gene ID - Rat ENSRNOG00000005564
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UBN2 pAb (ATL-HPA020124)
Datasheet Anti UBN2 pAb (ATL-HPA020124) Datasheet (External Link)
Vendor Page Anti UBN2 pAb (ATL-HPA020124) at Atlas Antibodies

Documents & Links for Anti UBN2 pAb (ATL-HPA020124)
Datasheet Anti UBN2 pAb (ATL-HPA020124) Datasheet (External Link)
Vendor Page Anti UBN2 pAb (ATL-HPA020124)